The store will not work correctly when cookies are disabled.
Protein or Target Summary
Peroxiredoxin-like 2C
| Gene ID | 195827 |
|---|
| uniprot | Q7RTV5 |
|---|
| Gene Name | PRXL2C |
|---|
| Ensernbl ID | ENSP00000364382 |
|---|
| Family | Belongs to the peroxiredoxin-like PRXL2 family. PRXL2C subfamily. |
|---|
| Sequence | MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 195827 | PRXL2C | Peroxiredoxin-like 2C | Q7RTV5 |
| MOUSE | 66129 | Prxl2c | Peroxiredoxin-like 2C | Q9D1A0 |
| RAT | 498685 | Prxl2c | AhpC/TSA antioxidant enzyme domain containing 1 | D3ZAK1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
