The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 5216 |
|---|
| Uniprot Accession IDs | Q53Y44 |
|---|
| Ensembl ID | ENSP00000225655 |
|---|
| Symbol | ALS18 |
|---|
| Family | Belongs to the profilin family. |
|---|
| Sequence | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 748477 | PFN1 | profilin 1 | 9598 | VGNC:9511 | OMA, EggNOG |
| Macaque | 710753 | PFN1 | profilin 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18643 | Pfn1 | profilin 1 | 10090 | MGI:97549 | Inparanoid, OMA, EggNOG |
| Rat | 64303 | Pfn1 | profilin 1 | 10116 | RGD:621825 | Inparanoid, OMA, EggNOG |
| Dog | 607397 | PFN1 | profilin 1 | 9615 | VGNC:53432 | Inparanoid, OMA, EggNOG |
| Horse | 100061295 | PFN1 | profilin 1 | 9796 | | OMA, EggNOG |
| Cow | 513895 | PFN1 | profilin 1 | 9913 | | OMA, EggNOG |
| Pig | 100512494 | PFN1 | profilin 1 | 9823 | | Inparanoid, EggNOG |
| Opossum | 100016522 | PFN1 | profilin 1 | 13616 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
