The store will not work correctly when cookies are disabled.
PROK1
Description | Prokineticin-1 |
---|
Gene and Protein Information
Gene ID | 84432 |
Uniprot Accession IDs | Q5VWD4 Q8TC69 |
Ensembl ID | ENSP00000271331 |
Symbol | PK1 PRK1 EGVEGF |
Family | Belongs to the AVIT (prokineticin) family. |
Sequence | MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 745259 | PROK1 | prokineticin 1 | 9598 | VGNC:6963 | OMA, EggNOG |
Macaque | 701766 | PROK1 | prokineticin 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 246691 | Prok1 | prokineticin 1 | 10090 | MGI:2180370 | Inparanoid, OMA, EggNOG |
Rat | 192205 | Prok1 | prokineticin 1 | 10116 | RGD:620898 | Inparanoid, OMA, EggNOG |
Dog | 100856124 | PROK1 | prokineticin 1 | 9615 | VGNC:45010 | Inparanoid, OMA, EggNOG |
Horse | 100058664 | PROK1 | prokineticin 1 | 9796 | VGNC:21872 | Inparanoid, OMA, EggNOG |
Cow | 617599 | PROK1 | prokineticin 1 | 9913 | VGNC:33361 | Inparanoid, OMA, EggNOG |
Pig | 100359362 | PROK1 | prokineticin 1 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100030256 | PROK1 | prokineticin 1 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100077167 | PROK1 | prokineticin 1 | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 428257 | PROK1 | prokineticin 1 | 9031 | CGNC:253 | Inparanoid, OMA |
Anole lizard | 103278696 | prok1 | prokineticin 1 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | | PROK1 | prokineticin 1 [Source:HGNC Symbol;Acc:HGNC:18454] | 8364 | | OMA, EggNOG |
Zebrafish | 100126018 | prok1 | prokineticin 1 | 7955 | ZDB-GENE-070928-34 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|