The store will not work correctly when cookies are disabled.
Protein or Target Summary
Opiorphin prepropeptide
| Gene ID | 58503 |
|---|
| uniprot | Q99935 |
|---|
| Gene Name | OPRPN |
|---|
| Ensernbl ID | ENSP00000382485 |
|---|
| Family | Belongs to the PROL1/PROL3 family. |
|---|
| Sequence | MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPPPPYDSRLNSPLSLPFVPGRVPPSSFSRFSQAVILSQLFPLESIRQPRLFPGYPNLHFPLRPYYVGPIRILKPPFPPIPFFLAIYLPISNPEPQINITTADTTITTNPPTTATATTSTSTKPTMTISSSTVPISSTPEPATSISAATPAASTENTTQILANRPHTVLLNATVQVTTSNQTILSSPAFKSFWQKLFAIFG Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 58503 | OPRPN | Opiorphin prepropeptide | Q99935 |
| RAT | | Oprpn | Opiorphin prepropeptide | E9PTY1 |
| RAT | 65182 | Oprpn | Apomucin | Q62605 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
