Protein or Target Summary
Prolactin
| Gene ID | 5617 |
|---|---|
| uniprot | P01236 |
| Gene Name | PRL |
| Ensernbl ID | ENSP00000302150 |
| Family | Belongs to the somatotropin/prolactin family. |
| Sequence | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5617 | PRL | Prolactin | P01236 |
| MOUSE | Prl | Prolactin | P06879 | |
| MOUSE | Prl | Uncharacterized protein | Q9CYL2 | |
| MOUSE | Prl | Uncharacterized protein | Q9CYL8 | |
| MOUSE | 19109 | Prl | Prolactin, isoform CRA_b | Q3TT66 |
| MOUSE | 19109 | Prl | Growth hormone a1 | Q9CPQ2 |
| MOUSE | Prl | Prolactin | Q9CPQ0 | |
| RAT | 24683 | Prl | Growth hormone a1 | B5DEM6 |
| RAT | 24683 | Prl | Prl protein | B2RYT1 |
| RAT | Prl | Prolactin | Q58AV0 | |
| RAT | 24683 | Prl | Prolactin | P01237 |
Protein Classes
PANTHER Classes
protein / signaling molecule / peptide hormone / Prolactin
protein / signaling molecule / growth factor / Prolactin
protein / signaling molecule / peptide hormone / Prolactin
protein / signaling molecule / growth factor / Prolactin
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx