The store will not work correctly when cookies are disabled.
PRL
Gene and Protein Information
| Gene ID | 5617 |
|---|
| Uniprot Accession IDs | Q15199 Q92996 PRL |
|---|
| Ensembl ID | ENSP00000302150 |
|---|
| Symbol | GHA1 |
|---|
| Family | Belongs to the somatotropin/prolactin family. |
|---|
| Sequence | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 462468 | PRL | prolactin | 9598 | VGNC:3671 | OMA, EggNOG |
| Macaque | 707052 | PRL | prolactin | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 19109 | Prl | prolactin | 10090 | MGI:97762 | Inparanoid, OMA, EggNOG |
| Rat | 24683 | Prl | prolactin | 10116 | RGD:3403 | Inparanoid, OMA, EggNOG |
| Dog | 488241 | PRL | prolactin | 9615 | VGNC:44992 | Inparanoid, OMA, EggNOG |
| Horse | 100034034 | PRL | prolactin | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 280901 | PRL | prolactin | 9913 | | Inparanoid, OMA, EggNOG |
| Opossum | 100017831 | PRL | prolactin | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | PRL | prolactin [Source:HGNC Symbol;Acc:HGNC:9445] | 9258 | | OMA, EggNOG |
| Chicken | 396453 | PRL | prolactin | 9031 | CGNC:9616 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561954 | prl | prolactin | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100101709 | prl.1 | prolactin, gene 1 | 8364 | XB-GENE-482866 | Inparanoid, OMA |
| Zebrafish | 799612 | prl2 | prolactin 2 | 7955 | ZDB-GENE-041210-160 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
