PRL

Description	Prolactin

Gene and Protein Information

Gene ID	5617
Uniprot Accession IDs	Q15199 Q92996 PRL
Ensembl ID	ENSP00000302150
Symbol	GHA1
Family	Belongs to the somatotropin/prolactin family.
Sequence	MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462468	PRL	prolactin	9598	VGNC:3671	OMA, EggNOG
Macaque	707052	PRL	prolactin	9544		Inparanoid, OMA, EggNOG
Mouse	19109	Prl	prolactin	10090	MGI:97762	Inparanoid, OMA, EggNOG
Rat	24683	Prl	prolactin	10116	RGD:3403	Inparanoid, OMA, EggNOG
Dog	488241	PRL	prolactin	9615	VGNC:44992	Inparanoid, OMA, EggNOG
Horse	100034034	PRL	prolactin	9796		Inparanoid, OMA, EggNOG
Cow	280901	PRL	prolactin	9913		Inparanoid, OMA, EggNOG
Opossum	100017831	PRL	prolactin	13616		Inparanoid, OMA, EggNOG
Platypus		PRL	prolactin [Source:HGNC Symbol;Acc:HGNC:9445]	9258		OMA, EggNOG
Chicken	396453	PRL	prolactin	9031	CGNC:9616	Inparanoid, OMA, EggNOG
Anole lizard	100561954	prl	prolactin	28377		Inparanoid, OMA, EggNOG
Xenopus	100101709	prl.1	prolactin, gene 1	8364	XB-GENE-482866	Inparanoid, OMA
Zebrafish	799612	prl2	prolactin 2	7955	ZDB-GENE-041210-160	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein / signaling molecule / peptide hormone / Prolactin
protein / signaling molecule / growth factor / Prolactin

DTO Classes
protein / Signaling / Growth factor / Prolactin

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]

PRL