The store will not work correctly when cookies are disabled.
PROK2
| Description | Prokineticin-2 |
|---|
Gene and Protein Information
| Gene ID | 60675 |
|---|
| Uniprot Accession IDs | Q53Z79 Q6ISR0 PK2 |
|---|
| Ensembl ID | ENSP00000295619 |
|---|
| Symbol | BV8 BV8 HH4 PK2 KAL4 MIT1 |
|---|
| Family | Belongs to the AVIT (prokineticin) family. |
|---|
| Sequence | MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736902 | PROK2 | prokineticin 2 | 9598 | VGNC:2524 | OMA, EggNOG |
| Macaque | 694450 | PROK2 | prokineticin 2 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 50501 | Prok2 | prokineticin 2 | 10090 | MGI:1354178 | Inparanoid, OMA, EggNOG |
| Rat | 192206 | Prok2 | prokineticin 2 | 10116 | RGD:620280 | Inparanoid, OMA, EggNOG |
| Cow | 387602 | PROK2 | prokineticin 2 | 9913 | VGNC:33362 | Inparanoid, OMA, EggNOG |
| Pig | 100526076 | PROK2 | prokineticin 2 | 9823 | | OMA, EggNOG |
| Opossum | 100020601 | PROK2 | prokineticin 2 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 771674 | PROK2 | prokineticin 2 | 9031 | CGNC:5886 | Inparanoid, EggNOG |
| Anole lizard | | PROK2 | prokineticin 2 [Source:HGNC Symbol;Acc:HGNC:18455] | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
