The store will not work correctly when cookies are disabled.
Protein or Target Summary
Prolactin-releasing peptide
| Gene ID | 51052 |
|---|
| uniprot | P81277 |
|---|
| Gene Name | PRLH |
|---|
| Ensernbl ID | ENSP00000165524 |
|---|
| Sequence | MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDG Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 51052 | PRLH | Prolactin-releasing peptide | P81277 |
| MOUSE | | Prlh | Prolactin-releasing peptide | B7U2G4 |
| MOUSE | 623503 | Prlh | MCG12871 | G3UWC3 |
| RAT | 63850 | Prlh | Prolactin-releasing peptide | P81278 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
