Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

SGK2

DescriptionSerine/threonine-protein kinase Sgk2

Gene and Protein Information

Gene ID10110
Uniprot Accession IDs Q52PK5 Q5H8Y6 Q5H8Z1 Q5TZR3 Q9UKG6
Ensembl ID ENSP00000340608
Symbol H-SGK2 dJ138B7.2
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Sequence
MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp740699SGK2SGK2, serine/threonine kinase 29598VGNC:10267OMA, EggNOG
Macaque695356SGK2SGK2, serine/threonine kinase 29544Inparanoid, OMA, EggNOG
Mouse27219Sgk2serum/glucocorticoid regulated kinase 210090MGI:1351318Inparanoid, OMA, EggNOG
Rat171497Sgk2SGK2, serine/threonine kinase 210116RGD:620232Inparanoid, OMA, EggNOG
Horse100147213SGK2SGK2, serine/threonine kinase 29796VGNC:22917Inparanoid, OMA, EggNOG
Cow517909SGK2SGK2, serine/threonine kinase 29913VGNC:34542Inparanoid, OMA, EggNOG
Pig100157757SGK2SGK2, serine/threonine kinase 29823OMA, EggNOG
Opossum100032629SGK2SGK2, serine/threonine kinase 213616Inparanoid, EggNOG
Chicken419166SGK2SGK2, serine/threonine kinase 29031CGNC:2582Inparanoid, OMA, EggNOG
Anole lizard100566896sgk2SGK2, serine/threonine kinase 228377Inparanoid, OMA, EggNOG
Xenopus100036607sgk2serum/glucocorticoid regulated kinase 28364XB-GENE-982512Inparanoid, OMA, EggNOG
Zebrafish570956sgk2aserum/glucocorticoid regulated kinase 2a7955ZDB-GENE-030131-9632OMA, EggNOG
C. elegans181697sgk-1Serine/threonine-protein kinase sgk-16239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    non-receptor serine/threonine protein kinase    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    transfer/carrier protein    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    protein kinase    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    calmodulin    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    transferase    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    annexin    /    Serine/threonine-protein kinase sgk2
protein    /    calcium-binding protein    /    kinase    /    Serine/threonine-protein kinase sgk2
DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    SGK family    /    Serine/threonine-protein kinase sgk2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.