The store will not work correctly when cookies are disabled.
Protein or Target Summary
CGG triplet repeat-binding protein 1
| Gene ID | 8545 |
|---|
| uniprot | Q9UFW8 |
|---|
| Gene Name | CGGBP1 |
|---|
| Ensernbl ID | ENSP00000381429 |
|---|
| Sequence | MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 8545 | CGGBP1 | CGG triplet repeat-binding protein 1 | Q9UFW8 |
| MOUSE | 106143 | Cggbp1 | CGG triplet repeat-binding protein 1 | Q8BHG9 |
| RAT | 288353 | Cggbp1 | CGG triplet repeat binding protein 1 (Predicted) | D4ADB4 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
