Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

SAA2

DescriptionSerum amyloid A-2 protein

Gene and Protein Information

Gene ID6289
Uniprot Accession IDs G3XAK9 P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA2
Ensembl ID ENSP00000436126
Symbol SAA SAA1
FamilyBelongs to the SAA family.
Sequence
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp748829SAA2serum amyloid A29598VGNC:1010OMA, EggNOG
Mouse20209Saa2serum amyloid A 210090MGI:98222Inparanoid, OMA, EggNOG
Dog751814SAA1serum amyloid A19615Inparanoid, OMA
HorseSAAEquus caballus serum amyloid A1 (SAA), mRNA. [Source:RefSeq mRNA;Acc:NM_001081853]9796OMA, EggNOG
Cow506412SAA2serum amyloid A29913OMA, EggNOG
Pig100525680SAA2serum amyloid A-2 protein9823OMA, EggNOG
Zebrafish449557saaserum amyloid A7955ZDB-GENE-040927-15OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transfer/carrier protein    /    defense/immunity protein    /    Serum amyloid A-2 protein
protein    /    transfer/carrier protein    /    apolipoprotein    /    Serum amyloid A-2 protein
protein    /    transfer/carrier protein    /    transporter    /    Serum amyloid A-2 protein
DTO Classes
protein    /    Transporter    /    Apolipoprotein    /    Serum amyloid A-2 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Yamada, T T, Wada, A A, Itoh, Y Y and Itoh, K K. 1999-09 Serum amyloid A1 alleles and plasma concentrations of serum amyloid A. [PMID:10524285]
      2.Stix, B B and 5 more authors. 2001-08 Proteolysis of AA amyloid fibril proteins by matrix metalloproteinases-1, -2, and -3. [PMID:11485914]
      3.Thorn, Caroline F CF and Whitehead, Alexander S AS. 2002-07-01 Differential glucocorticoid enhancement of the cytokine-driven transcriptional activation of the human acute phase serum amyloid A genes, SAA1 and SAA2. [PMID:12077270]
      4.Wang, Limin L, Lashuel, Hilal A HA, Walz, Thomas T and Colon, Wilfredo W. 2002-12-10 Murine apolipoprotein serum amyloid A in solution forms a hexamer containing a central channel. [PMID:12456883]
      5.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      6.Kumon, Yoshitaka Y and 5 more authors. 2002-12 Acute-phase, but not constitutive serum amyloid A (SAA) is chemotactic for cultured human aortic smooth muscle cells. [PMID:12557751]
      7.Ribeiro, Fernanda Pereira FP and 6 more authors. 2003-06 mRNA expression and release of interleukin-8 induced by serum amyloid A in neutrophils and monocytes. [PMID:12857601]
      8.Anderson, N Leigh NL and 10 more authors. 2004-04 The human plasma proteome: a nonredundant list developed by combination of four separate sources. [PMID:14718574]
      9.Thorn, C F CF, Lu, Z-Y ZY and Whitehead, A S AS. 2004-02 Regulation of the human acute phase serum amyloid A genes by tumour necrosis factor-alpha, interleukin-6 and glucocorticoids in hepatic and epithelial cell lines. [PMID:14871291]
      10.Bakkaloglu, Aysin A and 7 more authors. 2004-06 Influence of Serum Amyloid A (SAA1) and SAA2 gene polymorphisms on renal amyloidosis, and on SAA/C-reactive protein values in patients with familial mediterranean fever in the Turkish population. [PMID:15170927]