JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

SAA2

Description	Serum amyloid A-2 protein

Gene and Protein Information

Gene ID	6289
Uniprot Accession IDs	G3XAK9 P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA2
Ensembl ID	ENSP00000436126
Symbol	SAA SAA1
Family	Belongs to the SAA family.
Sequence	MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	748829	SAA2	serum amyloid A2	9598	VGNC:1010	OMA, EggNOG
Mouse	20209	Saa2	serum amyloid A 2	10090	MGI:98222	Inparanoid, OMA, EggNOG
Dog	751814	SAA1	serum amyloid A1	9615		Inparanoid, OMA
Horse		SAA	Equus caballus serum amyloid A1 (SAA), mRNA. [Source:RefSeq mRNA;Acc:NM_001081853]	9796		OMA, EggNOG
Cow	506412	SAA2	serum amyloid A2	9913		OMA, EggNOG
Pig	100525680	SAA2	serum amyloid A-2 protein	9823		OMA, EggNOG
Zebrafish	449557	saa	serum amyloid A	7955	ZDB-GENE-040927-15	OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transfer/carrier protein    /    defense/immunity protein    /    Serum amyloid A-2 protein
protein    /    transfer/carrier protein    /    apolipoprotein    /    Serum amyloid A-2 protein
protein    /    transfer/carrier protein    /    transporter    /    Serum amyloid A-2 protein

DTO Classes
protein / Transporter / Apolipoprotein / Serum amyloid A-2 protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]