The store will not work correctly when cookies are disabled.
SRD5A1
Description | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Gene and Protein Information
Gene ID | 6715 |
Uniprot Accession IDs | B2R7Q1 Q9UHY4 Q9UP36 Q9UP37 |
Ensembl ID | ENSP00000274192 |
Symbol | S5AR 1 |
Family | Belongs to the steroid 5-alpha reductase family. |
Sequence | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 743740 | SRD5A1 | steroid 5 alpha-reductase 1 | 9598 | VGNC:7155 | OMA, EggNOG |
Macaque | 695103 | SRD5A1 | steroid 5 alpha-reductase 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 78925 | Srd5a1 | steroid 5 alpha-reductase 1 | 10090 | MGI:98400 | Inparanoid, OMA, EggNOG |
Rat | 24950 | Srd5a1 | steroid 5 alpha-reductase 1 | 10116 | RGD:3757 | Inparanoid, OMA, EggNOG |
Dog | 403716 | SRD5A1 | steroid 5 alpha-reductase 1 | 9615 | VGNC:46793 | Inparanoid, OMA, EggNOG |
Horse | 100071450 | SRD5A1 | steroid 5 alpha-reductase 1 | 9796 | VGNC:23573 | Inparanoid, OMA, EggNOG |
Cow | 614612 | SRD5A1 | steroid 5 alpha-reductase 1 | 9913 | VGNC:35271 | Inparanoid, OMA, EggNOG |
Pig | 100518046 | SRD5A1 | steroid 5 alpha-reductase 1 | 9823 | | OMA, EggNOG |
Opossum | 100018123 | SRD5A1 | steroid 5 alpha-reductase 1 | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 770453 | SRD5A1 | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) | 9031 | CGNC:56034 | OMA, EggNOG |
Xenopus | 448586 | srd5a1 | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) | 8364 | XB-GENE-1000046 | Inparanoid, OMA, EggNOG |
Zebrafish | 767715 | srd5a1 | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) | 7955 | ZDB-GENE-060929-938 | Inparanoid, EggNOG |
C. elegans | 184699 | F19H6.4 | hypothetical protein | 6239 | | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|