The store will not work correctly when cookies are disabled.
Protein or Target Summary
3-oxo-5-alpha-steroid 4-dehydrogenase 1
| Gene ID | 6715 |
|---|
| uniprot | P18405 |
|---|
| Gene Name | SRD5A1 |
|---|
| Ensernbl ID | ENSP00000274192 |
|---|
| Family | Belongs to the steroid 5-alpha reductase family. |
|---|
| Sequence | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6715 | SRD5A1 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | P18405 |
| MOUSE | 78925 | Srd5a1 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | Q68FF9 |
| MOUSE | | Srd5a1 | Srd5a1 protein | Q14C32 |
| MOUSE | 78925 | Srd5a1 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | A0A0R4J136 |
| MOUSE | 78925 | Srd5a1 | Uncharacterized protein | Q8BUR8 |
| MOUSE | | Srd5a1 | Srd5a1 protein | Q14C33 |
| RAT | 24950 | Srd5a1 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | P24008 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
