Protein or Target Summary
Amiloride-sensitive sodium channel subunit alpha
| Gene ID | 6337 |
|---|---|
| uniprot | P37088 |
| Gene Name | SCNN1A |
| Ensernbl ID | ENSP00000353292 |
| Family | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1A subfamily. |
| Sequence | MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFEFFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 6337 | SCNN1A | Amiloride-sensitive sodium channel subunit alpha | P37088 |
| MOUSE | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | H3BKC4 | |
| MOUSE | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | H3BKW1 | |
| MOUSE | Scnn1a | Alpha ENaC | Q99PN8 | |
| MOUSE | Scnn1a | Epithelial sodium channel subunit alpha | Q924B6 | |
| MOUSE | Scnn1a | Scnn1a protein | Q80YC1 | |
| MOUSE | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | H3BLI2 | |
| MOUSE | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | H3BKP2 | |
| MOUSE | 20276 | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | Q3USG4 |
| MOUSE | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | H3BJC3 | |
| MOUSE | 20276 | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | Q61180 |
| RAT | Scnn1a | Epithelial sodium channel alpha subunit | Q9Z2W4 | |
| RAT | 25122 | Scnn1a | Amiloride sensitive sodium channel alpha1 subunit | Q6IRJ1 |
| RAT | 25122 | Scnn1a | Amiloride-sensitive sodium channel subunit alpha | P37089 |
Protein Classes
PANTHER Classes
protein / transporter / ion channel / Amiloride-sensitive sodium channel subunit alpha
protein / transporter / ion channel / Amiloride-sensitive sodium channel subunit alpha
DTO Classes
protein / Ion channel / Amiloride-sensitive sodium channel family / SCNN1A subfamily / Amiloride-sensitive sodium channel subunit alpha
protein / Ion channel / Amiloride-sensitive sodium channel family / SCNN1A subfamily / Amiloride-sensitive sodium channel subunit alpha
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx