Protein or Target Summary
Proton-coupled amino acid transporter 2
| Gene ID | 153201 |
|---|---|
| uniprot | Q495M3 |
| Gene Name | SLC36A2 |
| Ensernbl ID | ENSP00000334223 |
| Family | Belongs to the amino acid/polyamine transporter 2 family. |
| Sequence | MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPFMDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTTFVR Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / transporter / amino acid transporter / Proton-coupled amino acid transporter 2
protein / transporter / amino acid transporter / Proton-coupled amino acid transporter 2
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC36 family of proton-coupled amino acid transporters / Proton-coupled amino acid transporter 2
protein / Transporter / SLC superfamily of solute carriers / SLC36 family of proton-coupled amino acid transporters / Proton-coupled amino acid transporter 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx