My Cart
You have no items in your shopping cart.
Description | Serum amyloid A-4 protein |
---|
Gene ID | 6291 |
---|---|
Uniprot Accession IDs | Q6FHJ4 |
Ensembl ID | ENSP00000278222 |
Symbol | CSAA CSAA C-SAA |
Family | Belongs to the SAA family. |
Sequence | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
1.Kumon, Y Y, Suehiro, T T, Hashimoto, K K and Sipe, J D JD. 2001-01 Dexamethasone, but not IL-1 alone, upregulates acute-phase serum amyloid A gene expression and production by cultured human aortic smooth muscle cells. [PMID:11169201] |
2.Yamada, T T, Miyake, N N, Itoh, K K and Igari, J J. 2001-01 Further characterization of serum amyloid A4 as a minor acute phase reactant and a possible nutritional marker. [PMID:11256804] |
3.Xu, X R XR and 27 more authors. 2001-12-18 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver. [PMID:11752456] |
4.Kumon, Y Y and 7 more authors. 2002-11 Transcriptional regulation of serum amyloid A1 gene expression in human aortic smooth muscle cells involves CCAAT/enhancer binding proteins (C/EBP) and is distinct from HepG2 cells. [PMID:12410800] |
5.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932] |
6.Watson, G G, Coade, S S and Woo, P P. 1992-11 Analysis of the genomic and derived protein structure of a novel human serum amyloid A gene, SAA4. [PMID:1439582] |
7.Anderson, N Leigh NL and 10 more authors. 2004-04 The human plasma proteome: a nonredundant list developed by combination of four separate sources. [PMID:14718574] |
8.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334] |
9.Liu, Tao T and 6 more authors.Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. [PMID:16335952] |
10.Wang, Ai-Guo AG and 13 more authors. 2006-07-07 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags. [PMID:16712791] |