Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

SAA4

DescriptionSerum amyloid A-4 protein

Gene and Protein Information

Gene ID6291
Uniprot Accession IDs Q6FHJ4
Ensembl ID ENSP00000278222
Symbol CSAA CSAA C-SAA
FamilyBelongs to the SAA family.
Sequence
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse20211Saa4serum amyloid A 410090MGI:98224Inparanoid, EggNOG
Cow505308SAA4serum amyloid A4, constitutive9913Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    transfer/carrier protein    /    defense/immunity protein    /    Serum amyloid A-4 protein
protein    /    transfer/carrier protein    /    apolipoprotein    /    Serum amyloid A-4 protein
protein    /    transfer/carrier protein    /    transporter    /    Serum amyloid A-4 protein
DTO Classes
protein    /    Transporter    /    Apolipoprotein    /    Serum amyloid A-4 protein

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Kumon, Y Y, Suehiro, T T, Hashimoto, K K and Sipe, J D JD. 2001-01 Dexamethasone, but not IL-1 alone, upregulates acute-phase serum amyloid A gene expression and production by cultured human aortic smooth muscle cells. [PMID:11169201]
      2.Yamada, T T, Miyake, N N, Itoh, K K and Igari, J J. 2001-01 Further characterization of serum amyloid A4 as a minor acute phase reactant and a possible nutritional marker. [PMID:11256804]
      3.Xu, X R XR and 27 more authors. 2001-12-18 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver. [PMID:11752456]
      4.Kumon, Y Y and 7 more authors. 2002-11 Transcriptional regulation of serum amyloid A1 gene expression in human aortic smooth muscle cells involves CCAAT/enhancer binding proteins (C/EBP) and is distinct from HepG2 cells. [PMID:12410800]
      5.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      6.Watson, G G, Coade, S S and Woo, P P. 1992-11 Analysis of the genomic and derived protein structure of a novel human serum amyloid A gene, SAA4. [PMID:1439582]
      7.Anderson, N Leigh NL and 10 more authors. 2004-04 The human plasma proteome: a nonredundant list developed by combination of four separate sources. [PMID:14718574]
      8.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      9.Liu, Tao T and 6 more authors.Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. [PMID:16335952]
      10.Wang, Ai-Guo AG and 13 more authors. 2006-07-07 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags. [PMID:16712791]