The store will not work correctly when cookies are disabled.
SAA4
Description | Serum amyloid A-4 protein |
---|
Gene and Protein Information
Gene ID | 6291 |
Uniprot Accession IDs | Q6FHJ4 |
Ensembl ID | ENSP00000278222 |
Symbol | CSAA CSAA C-SAA |
Family | Belongs to the SAA family. |
Sequence | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Mouse | 20211 | Saa4 | serum amyloid A 4 | 10090 | MGI:98224 | Inparanoid, EggNOG |
Cow | 505308 | SAA4 | serum amyloid A4, constitutive | 9913 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|