Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

S100B

DescriptionProtein S100-B

Gene and Protein Information

Gene ID6285
Uniprot Accession IDs D3DSN6
Ensembl ID ENSP00000291700
Symbol NEF S100 S100-B S100beta
FamilyBelongs to the S-100 family.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp474141S100BS100 calcium binding protein B9598VGNC:1125OMA, EggNOG
Macaque708117S100BS100 calcium binding protein B9544Inparanoid, OMA, EggNOG
Mouse20203S100bS100 protein, beta polypeptide, neural10090MGI:98217Inparanoid, OMA, EggNOG
Rat25742S100bS100 calcium binding protein B10116RGD:3615Inparanoid, OMA, EggNOG
Dog491615S100BS100 calcium binding protein B9615VGNC:49642Inparanoid, OMA, EggNOG
Horse100054841S100BS100 calcium binding protein B9796VGNC:22656Inparanoid, OMA, EggNOG
Cow525716S100BS100 calcium binding protein B9913VGNC:34248Inparanoid, OMA, EggNOG
Pig100623510S100BS100 calcium binding protein B9823OMA, EggNOG
PlatypusS100BS100 calcium binding protein B [Source:HGNC Symbol;Acc:HGNC:10500]9258OMA, EggNOG
Chicken424038S100BS100 calcium binding protein B9031CGNC:4668Inparanoid, OMA, EggNOG
Zebrafish436825s100bS100 calcium binding protein, beta (neural)7955ZDB-GENE-040718-290Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-B
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-B
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-B

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details
Recombinant Human S100B ProteinE. coliN-His
In stock
Expand

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      atypical teratoid / rhabdoid tumor5491Expression AtlasMONDO:0020560
      breast cancer3880Expression AtlasMONDO:0007254
      breast carcinoma2011Expression AtlasMONDO:0004989
      colon cancer1587Expression AtlasMONDO:0021063
      Down syndrome498Expression AtlasMONDO:0008608
      ductal carcinoma in situ1737Expression AtlasMONDO:0005023
      group 3 medulloblastoma7142Expression AtlasMONDO:0007959
      interstitial cystitis2307Expression AtlasMONDO:0018301
      invasive ductal carcinoma2965Expression AtlasMONDO:0004953
      medulloblastoma, large-cell6269Expression AtlasMONDO:0002791

      Bibliography

      1.Hofmann, M A MA and 17 more authors. 1999-06-25 RAGE mediates a novel proinflammatory axis: a central cell surface receptor for S100/calgranulin polypeptides. [PMID:10399917]
      2.Garbuglia, M M and 6 more authors. 1999-10 The calcium-modulated proteins, S100A1 and S100B, as potential regulators of the dynamics of type III intermediate filaments. [PMID:10510252]
      3.Kislinger, T T and 10 more authors. 1999-10-29 N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression. [PMID:10531386]
      4.Hattori, M M and 64 more authors. 2000-05-18 The DNA sequence of human chromosome 21. [PMID:10830953]
      5.Rustandi, R R RR, Baldisseri, D M DM and Weber, D J DJ. 2000-07 Structure of the negative regulatory domain of p53 bound to S100B(betabeta). [PMID:10876243]
      6.Deloulme, J C JC and 5 more authors. 2000-11-10 S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. [PMID:10913138]
      7.Yu, W H WH and Fraser, P E PE. 2001-04-01 S100beta interaction with tau is promoted by zinc and inhibited by hyperphosphorylation in Alzheimer's disease. [PMID:11264299]
      8.Gentil, B J BJ and 6 more authors. 2001-06-29 The giant protein AHNAK is a specific target for the calcium- and zinc-binding S100B protein: potential implications for Ca2+ homeostasis regulation by S100B. [PMID:11312263]
      9.Chen, H H and 5 more authors. 2001-09-07 Binding to intracellular targets of the metastasis-inducing protein, S100A4 (p9Ka). [PMID:11527429]
      10.McClintock, Kimberly A KA, Van Eldik, Linda J LJ and Shaw, Gary S GS. 2002-04-30 The C-terminus and linker region of S100B exert dual control on protein-protein interactions with TRTK-12. [PMID:11969402]