| Description | Protein S100-B |
|---|
Gene and Protein Information
| Gene ID | 6285 |
|---|---|
| Uniprot Accession IDs | D3DSN6 |
| Ensembl ID | ENSP00000291700 |
| Symbol | NEF S100 S100-B S100beta |
| Family | Belongs to the S-100 family. |
| Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 474141 | S100B | S100 calcium binding protein B | 9598 | VGNC:1125 | OMA, EggNOG |
| Macaque | 708117 | S100B | S100 calcium binding protein B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20203 | S100b | S100 protein, beta polypeptide, neural | 10090 | MGI:98217 | Inparanoid, OMA, EggNOG |
| Rat | 25742 | S100b | S100 calcium binding protein B | 10116 | RGD:3615 | Inparanoid, OMA, EggNOG |
| Dog | 491615 | S100B | S100 calcium binding protein B | 9615 | VGNC:49642 | Inparanoid, OMA, EggNOG |
| Horse | 100054841 | S100B | S100 calcium binding protein B | 9796 | VGNC:22656 | Inparanoid, OMA, EggNOG |
| Cow | 525716 | S100B | S100 calcium binding protein B | 9913 | VGNC:34248 | Inparanoid, OMA, EggNOG |
| Pig | 100623510 | S100B | S100 calcium binding protein B | 9823 | OMA, EggNOG | |
| Platypus | S100B | S100 calcium binding protein B [Source:HGNC Symbol;Acc:HGNC:10500] | 9258 | OMA, EggNOG | ||
| Chicken | 424038 | S100B | S100 calcium binding protein B | 9031 | CGNC:4668 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436825 | s100b | S100 calcium binding protein, beta (neural) | 7955 | ZDB-GENE-040718-290 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Protein S100-B
protein / calcium-binding protein / signaling molecule / Protein S100-B
protein / calcium-binding protein / calmodulin / Protein S100-B
protein / calcium-binding protein / signaling molecule / Protein S100-B
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-B
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-B
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|