SLC6A12

Description	Sodium- and chloride-dependent betaine transporter

Gene and Protein Information

Gene ID	6539
Uniprot Accession IDs	A0AV52 B2R992 D3DUN8
Ensembl ID	ENSP00000399136
Symbol	BGT1 GAT2 BGT-1
Family	Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A12 subfamily.
Sequence	MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467192	SLC6A12	solute carrier family 6 member 12	9598	VGNC:8546	OMA, EggNOG
Mouse	14411	Slc6a12	solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12	10090	MGI:95628	Inparanoid, OMA, EggNOG
Rat	50676	Slc6a12	solute carrier family 6 member 12	10116	RGD:620255	Inparanoid, OMA, EggNOG
Dog	404013	SLC6A12	solute carrier family 6 member 12	9615	VGNC:46455	Inparanoid, OMA, EggNOG
Cow	514339	SLC6A12	solute carrier family 6 member 12	9913	VGNC:34915	Inparanoid, OMA, EggNOG
Pig	100512716	SLC6A12	solute carrier family 6 member 12	9823		Inparanoid, OMA, EggNOG
Opossum	100016965	SLC6A12	solute carrier family 6 member 12	13616		Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / transporter / cation transporter / Sodium- and chloride-dependent betaine transporter

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC6 neurotransmitter transporter family / GABA transporter subfamily / Sodium- and chloride-dependent betaine transporter

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source