The store will not work correctly when cookies are disabled.
CSF2
| Description | Granulocyte-macrophage colony-stimulating factor |
|---|
Gene and Protein Information
| Gene ID | 1437 |
|---|
| Uniprot Accession IDs | Q14CE8 Q2VPI8 Q8NFI6 GM-CSF |
|---|
| Ensembl ID | ENSP00000296871 |
|---|
| Symbol | GMCSF CSF GMCSF |
|---|
| Family | Belongs to the GM-CSF family. |
|---|
| Sequence | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471627 | CSF2 | colony stimulating factor 2 | 9598 | VGNC:6847 | OMA, EggNOG |
| Macaque | 574371 | CSF2 | colony stimulating factor 2 | 9544 | | OMA, EggNOG |
| Mouse | 12981 | Csf2 | colony stimulating factor 2 (granulocyte-macrophage) | 10090 | MGI:1339752 | Inparanoid, OMA, EggNOG |
| Rat | 116630 | Csf2 | colony stimulating factor 2 | 10116 | RGD:621065 | Inparanoid, OMA, EggNOG |
| Dog | 403923 | CSF2 | colony stimulating factor 2 | 9615 | VGNC:39654 | Inparanoid, OMA, EggNOG |
| Horse | 100033981 | CSF2 | colony stimulating factor 2 | 9796 | VGNC:16897 | OMA, EggNOG |
| Cow | 281095 | CSF2 | colony stimulating factor 2 | 9913 | VGNC:27755 | Inparanoid, OMA, EggNOG |
| Pig | 397208 | CSF2 | colony stimulating factor 2 | 9823 | | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes protein /
Signaling /
Cytokine / Granulocyte-macrophage colony-stimulating factor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
