My Cart
You have no items in your shopping cart.
Description | Granulocyte-macrophage colony-stimulating factor |
---|
Gene ID | 1437 |
---|---|
Uniprot Accession IDs | Q14CE8 Q2VPI8 Q8NFI6 GM-CSF |
Ensembl ID | ENSP00000296871 |
Symbol | GMCSF CSF GMCSF |
Family | Belongs to the GM-CSF family. |
Sequence | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 471627 | CSF2 | colony stimulating factor 2 | 9598 | VGNC:6847 | OMA, EggNOG |
Macaque | 574371 | CSF2 | colony stimulating factor 2 | 9544 | OMA, EggNOG | |
Mouse | 12981 | Csf2 | colony stimulating factor 2 (granulocyte-macrophage) | 10090 | MGI:1339752 | Inparanoid, OMA, EggNOG |
Rat | 116630 | Csf2 | colony stimulating factor 2 | 10116 | RGD:621065 | Inparanoid, OMA, EggNOG |
Dog | 403923 | CSF2 | colony stimulating factor 2 | 9615 | VGNC:39654 | Inparanoid, OMA, EggNOG |
Horse | 100033981 | CSF2 | colony stimulating factor 2 | 9796 | VGNC:16897 | OMA, EggNOG |
Cow | 281095 | CSF2 | colony stimulating factor 2 | 9913 | VGNC:27755 | Inparanoid, OMA, EggNOG |
Pig | 397208 | CSF2 | colony stimulating factor 2 | 9823 | Inparanoid, OMA, EggNOG |
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|---|---|---|---|---|
Recombinant Human GM-CSF Protein | E.coli | No tag |
Out of Stock
| Expand⌵ | |
Recombinant Mouse GM-CSF Protein | HEK293 | N-His |
Out of Stock
| Expand⌵ | |
Recombinant Rat GM-CSF Protein | E.coli | No tag |
Out of Stock
| Expand⌵ | |
Recombinant Human GM-CSF GMP Protein | E. coli | No tag |
Out of Stock
| Expand⌵ | |
Recombinant Human GM-CSF Protein | E. coli | N-His |
Out of Stock
| Expand⌵ | |
Recombinant Porcine GM-CSF Protein | HEK293 | C-His |
Out of Stock
| Expand⌵ | |
Recombinant Human GM-CSF Protein |
Out of Stock
| Expand⌵ |
Name | Direct Associated Targets | Disease Type | Mondoid |
---|---|---|---|
cystic fibrosis | 1831 | Expression Atlas | MONDO:0009061 |
psoriasis | 6696 | Expression Atlas | MONDO:0005083 |
Agranulocytosis | 8 | CTD | MONDO:0001609 |
Amnesia | 17 | CTD | MONDO:0001152 |
Amnesia | 17 | CTD | MONDO:0001185 |
Anemia | 31 | CTD | MONDO:0002280 |
Anemia, Aplastic | 47 | CTD | MONDO:0015909 |
Arthritis, Rheumatoid | 974 | CTD | MONDO:0008383 |
Bone Marrow failure syndromes | 4 | CTD | MONDO:0000159 |
Breast Neoplasms | 3880 | CTD | MONDO:0007254 |
1.Stomski, F C FC and 9 more authors. 1999-09-15 Identification of a 14-3-3 binding sequence in the common beta chain of the granulocyte-macrophage colony-stimulating factor (GM-CSF), interleukin-3 (IL-3), and IL-5 receptors that is serine-phosphorylated by GM-CSF. [PMID:10477722] |
2.Niu, L L, Golde, D W DW, Vera, J C JC and Heaney, M L ML. 1999-12-01 Kinetic resolution of two mechanisms for high-affinity granulocyte-macrophage colony-stimulating factor binding to its receptor. [PMID:10572088] |
3.Scheuerer, B B and 7 more authors. 2000-02-15 The CXC-chemokine platelet factor 4 promotes monocyte survival and induces monocyte differentiation into macrophages. [PMID:10666185] |
4.Modrowski, D D, Baslé, M M, Lomri, A A and Marie, P J PJ. 2000-03-31 Syndecan-2 is involved in the mitogenic activity and signaling of granulocyte-macrophage colony-stimulating factor in osteoblasts. [PMID:10734053] |
5.Kajita, M M and 6 more authors. 2001 Novel single nucleotide polymorphisms of the human colony-stimulating factor 2 (CSF2) gene identified by sequencing the entire gene. [PMID:11289721] |
6.Seldon, P M PM and Giembycz, M A MA. 2001-09 Suppression of granulocyte/macrophage colony-stimulating factor release from human monocytes by cyclic AMP-elevating drugs: role of interleukin-10. [PMID:11522597] |
7.Allam, M M and Renzi, P M PM. 2001-10 Inhibition of GM-CSF/IL-3/IL-5 signaling by antisense oligodeoxynucleotides targeting the common beta chain of their receptors. [PMID:11763346] |
8.Feugier, Pierre P and 6 more authors. 2002-02 Ex vivo expansion of stem and progenitor cells in co-culture of mobilized peripheral blood CD34+ cells on human endothelium transfected with adenovectors expressing thrombopoietin, c-kit ligand, and Flt-3 ligand. [PMID:11847009] |
9.Pituch-Noworolska, A A, Hajto, B B, Balwierz, W W and Klus, K K. 2001 Induction of apoptosis and bcl-2 expression in acute lymphoblastic leukaemia and non-Hodgkin's lymphoma in children. [PMID:11855781] |
10.Sabatini, Federica F, Silvestri, Michela M, Scarso, Lucia L, Brazzola, Giancarlo G and Rossi, Giovanni A GA. 2002-02 The antiinflammatory activity of budesonide on human airway epithelial cells is lasting after removal of the drug from cultures. [PMID:11883735] |