The store will not work correctly when cookies are disabled.
SLC22A1
| Description | Solute carrier family 22 member 1 |
|---|
Gene and Protein Information
| Gene ID | 6580 |
|---|
| Uniprot Accession IDs | A6NFF3 A8K1H2 C9JSU6 O15395 Q9NQD4 |
|---|
| Ensembl ID | ENSP00000355930 |
|---|
| Symbol | OCT1 OCT1 HOCT1 oct1_cds |
|---|
| Family | Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. |
|---|
| Sequence | MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472177 | SLC22A1 | solute carrier family 22 member 1 | 9598 | VGNC:7917 | Inparanoid, OMA, EggNOG |
| Macaque | 703449 | SLC22A1 | solute carrier family 22 member 1 | 9544 | | OMA, EggNOG |
| Mouse | 20517 | Slc22a1 | solute carrier family 22 (organic cation transporter), member 1 | 10090 | MGI:108111 | Inparanoid, OMA |
| Rat | 24904 | Slc22a1 | solute carrier family 22 member 1 | 10116 | RGD:3224 | Inparanoid, OMA |
| Dog | 484068 | SLC22A1 | solute carrier family 22 member 1 | 9615 | VGNC:46270 | Inparanoid, OMA |
| Horse | 100058455 | SLC22A1 | solute carrier family 22 member 1 | 9796 | VGNC:23068 | Inparanoid, OMA |
| Cow | 519461 | SLC22A1 | solute carrier family 22 member 1 | 9913 | VGNC:34719 | Inparanoid, OMA |
| Opossum | 100027984 | SLC22A1 | solute carrier family 22 member 1 | 13616 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
