SAA1
| Description | Serum amyloid A-1 protein |
|---|
Gene and Protein Information
| Gene ID | 6288 |
|---|---|
| Uniprot Accession IDs | P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA |
| Ensembl ID | ENSP00000384906 |
| Symbol | SAA PIG4 SAA2 TP53I4 |
| Family | Belongs to the SAA family. |
| Sequence | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Zebrafish | 449557 | saa | serum amyloid A | 7955 | ZDB-GENE-040927-15 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transfer/carrier protein / defense/immunity protein / Serum amyloid A-1 protein
protein / transfer/carrier protein / apolipoprotein / Serum amyloid A-1 protein
protein / transfer/carrier protein / transporter / Serum amyloid A-1 protein
protein / transfer/carrier protein / defense/immunity protein / Serum amyloid A-1 protein
protein / transfer/carrier protein / apolipoprotein / Serum amyloid A-1 protein
protein / transfer/carrier protein / transporter / Serum amyloid A-1 protein
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|