Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

SAA1

DescriptionSerum amyloid A-1 protein

Gene and Protein Information

Gene ID6288
Uniprot Accession IDs P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA
Ensembl ID ENSP00000384906
Symbol SAA PIG4 SAA2 TP53I4
FamilyBelongs to the SAA family.
Sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Zebrafish449557saaserum amyloid A7955ZDB-GENE-040927-15Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transfer/carrier protein    /    defense/immunity protein    /    Serum amyloid A-1 protein
protein    /    transfer/carrier protein    /    apolipoprotein    /    Serum amyloid A-1 protein
protein    /    transfer/carrier protein    /    transporter    /    Serum amyloid A-1 protein
DTO Classes
protein    /    Transporter    /    Apolipoprotein    /    Serum amyloid A-1 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      Bibliography

      The page will load shortly, Thanks for your patience!