Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

SAA1

DescriptionSerum amyloid A-1 protein

Gene and Protein Information

Gene ID6288
Uniprot Accession IDs P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA
Ensembl ID ENSP00000384906
Symbol SAA PIG4 SAA2 TP53I4
FamilyBelongs to the SAA family.
Sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Zebrafish449557saaserum amyloid A7955ZDB-GENE-040927-15Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transfer/carrier protein    /    defense/immunity protein    /    Serum amyloid A-1 protein
protein    /    transfer/carrier protein    /    apolipoprotein    /    Serum amyloid A-1 protein
protein    /    transfer/carrier protein    /    transporter    /    Serum amyloid A-1 protein
DTO Classes
protein    /    Transporter    /    Apolipoprotein    /    Serum amyloid A-1 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      Bibliography

      1.Kislinger, T T and 10 more authors. 1999-10-29 N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression. [PMID:10531386]
      2.Liang, T S TS, Wang, J M JM, Murphy, P M PM and Gao, J L JL. 2000-04-13 Serum amyloid A is a chemotactic agonist at FPR2, a low-affinity N-formylpeptide receptor on mouse neutrophils. [PMID:10753626]
      3.Chen, Y Y and 5 more authors. 2001-10 [The association between SA gene and essential hypertension in Han Chinese]. [PMID:11592044]
      4.Benditt, E P. EP, Eriksen, N N, Hermodson, M A. MA and Ericsson, L H. LH. 1971-12-01 The major proteins of human and monkey amyloid substance: Common properties including unusual N-terminal amino acid sequences. [PMID:11946204]
      5.Lundmark, Katarzyna K and 5 more authors. 2002-05-14 Transmissibility of systemic amyloidosis by a prion-like mechanism. [PMID:12011456]
      6.Walder, Ken K and 14 more authors. 2002-06 Tanis: a link between type 2 diabetes and inflammation? [PMID:12031974]
      7.Kisilevsky, Robert R and Tam, Shui-Pang SP.Acute phase serum amyloid A, cholesterol metabolism, and cardiovascular disease. [PMID:12056504]
      8.Thorn, Caroline F CF and Whitehead, Alexander S AS. 2002-07-01 Differential glucocorticoid enhancement of the cytokine-driven transcriptional activation of the human acute phase serum amyloid A genes, SAA1 and SAA2. [PMID:12077270]
      9.Kumon, Y Y and 7 more authors. 2002-11 Transcriptional regulation of serum amyloid A1 gene expression in human aortic smooth muscle cells involves CCAAT/enhancer binding proteins (C/EBP) and is distinct from HepG2 cells. [PMID:12410800]
      10.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]