The store will not work correctly when cookies are disabled.
Protein or Target Summary
Steroid receptor RNA activator 1
| Gene ID | 10011 |
|---|
| uniprot | Q9HD15 |
|---|
| Gene Name | SRA1 |
|---|
| Ensernbl ID | ENSP00000337513 |
|---|
| Family | Belongs to the SRA1 family. |
|---|
| Sequence | MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10011 | SRA1 | Steroid receptor RNA activator 1 | Q9HD15 |
| MOUSE | 24068 | Sra1 | Steroid receptor RNA activator 1 | Q80VJ2 |
| MOUSE | | Sra1 | Steroid receptor RNA activator 1 | G3X8R2 |
| MOUSE | | Sra1 | Steroid receptor RNA activator 1 | G3UZQ4 |
| RAT | 252891 | Sra1 | Steroid receptor RNA activator 1 | Q6QGW5 |
| RAT | | Sra1 | Sra1 protein | Q5BKE4 |
| RAT | 252891 | Sra1 | Steroid receptor RNA activator 1 | G3V8C6 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
