Protein or Target Summary
Chymotrypsin-like protease CTRL-1
Gene ID | 1506 |
---|---|
uniprot | P40313 |
Gene Name | CTRL |
Ensernbl ID | ENSP00000458537 |
Family | Belongs to the peptidase S1 family. |
Sequence | MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 1506 | CTRL | Chymotrypsin-like protease CTRL-1 | P40313 |
MOUSE | Ctrl | Uncharacterized protein | Q9D960 | |
MOUSE | Ctrl | Uncharacterized protein | Q9DC82 | |
MOUSE | Ctrl | Uncharacterized protein | Q9D7P8 | |
MOUSE | 109660 | Ctrl | Chymopasin | Q9ER05 |
RAT | 117184 | Ctrl | Chymopasin | Q9EQZ8 |
RAT | Ctrl | Chymotrypsin-like | G3V8J3 |
Protein Classes
PANTHER Classes
protein / serine protease / Chymotrypsin-like protease CTRL-1
protein / protease / Chymotrypsin-like protease CTRL-1
protein / hydrolase / Chymotrypsin-like protease CTRL-1
protein / serine protease / Chymotrypsin-like protease CTRL-1
protein / protease / Chymotrypsin-like protease CTRL-1
protein / hydrolase / Chymotrypsin-like protease CTRL-1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx