JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

CTRL

Description	Chymotrypsin-like protease CTRL-1

Gene and Protein Information

Gene ID	1506
Uniprot Accession IDs	P40313
Ensembl ID	ENSP00000458537
Symbol	CTRL1 CTRL1
Family	Belongs to the peptidase S1 family.
Sequence	MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454179	CTRL	chymotrypsin like	9598	VGNC:9027	OMA, EggNOG
Macaque	701625	CTRL	chymotrypsin like	9544		Inparanoid, OMA, EggNOG
Mouse	109660	Ctrl	chymotrypsin-like	10090	MGI:88558	Inparanoid, OMA, EggNOG
Rat	117184	Ctrl	chymotrypsin-like	10116	RGD:621501	Inparanoid, OMA, EggNOG
Dog	611100	CTRL	chymotrypsin like	9615	VGNC:39707	Inparanoid, OMA, EggNOG
Pig	100621609	CTRL	chymotrypsin like	9823		OMA, EggNOG
Opossum	100021711	CTRL	chymotrypsin like	13616		Inparanoid, EggNOG
Platypus		CTRL	chymotrypsin like [Source:HGNC Symbol;Acc:HGNC:2524]	9258		OMA, EggNOG
Anole lizard	100554181	ctrl	chymotrypsin like	28377		Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    serine protease    /    Chymotrypsin-like protease CTRL-1
protein    /    protease    /    Chymotrypsin-like protease CTRL-1
protein    /    hydrolase    /    Chymotrypsin-like protease CTRL-1

DTO Classes
protein / Enzyme / Protease / Serine protease / Chymotrypsin-like protease CTRL-1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]