Protein or Target Summary
Chymotrypsin-like protease CTRL-1
| Gene ID | 1506 |
|---|---|
| uniprot | P40313 |
| Gene Name | CTRL |
| Ensernbl ID | ENSP00000458537 |
| Family | Belongs to the peptidase S1 family. |
| Sequence | MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 1506 | CTRL | Chymotrypsin-like protease CTRL-1 | P40313 |
| MOUSE | Ctrl | Uncharacterized protein | Q9D960 | |
| MOUSE | Ctrl | Uncharacterized protein | Q9DC82 | |
| MOUSE | Ctrl | Uncharacterized protein | Q9D7P8 | |
| MOUSE | 109660 | Ctrl | Chymopasin | Q9ER05 |
| RAT | 117184 | Ctrl | Chymopasin | Q9EQZ8 |
| RAT | Ctrl | Chymotrypsin-like | G3V8J3 |
Protein Classes
PANTHER Classes
protein / serine protease / Chymotrypsin-like protease CTRL-1
protein / protease / Chymotrypsin-like protease CTRL-1
protein / hydrolase / Chymotrypsin-like protease CTRL-1
protein / serine protease / Chymotrypsin-like protease CTRL-1
protein / protease / Chymotrypsin-like protease CTRL-1
protein / hydrolase / Chymotrypsin-like protease CTRL-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx