JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
RSAD2

RSAD2

Description	Radical S-adenosyl methionine domain-containing protein 2

Gene and Protein Information

Gene ID	91543
Uniprot Accession IDs	Q8WVI4
Ensembl ID	ENSP00000371471
Symbol	CIG5 cig5 vig1 cig33 2510004L01Rik
Family	Belongs to the radical SAM superfamily. RSAD2 family.
Sequence	MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459006	RSAD2	radical S-adenosyl methionine domain containing 2	9598	VGNC:10754	OMA, EggNOG
Macaque	708720	RSAD2	radical S-adenosyl methionine domain containing 2	9544		Inparanoid, OMA, EggNOG
Mouse	58185	Rsad2	radical S-adenosyl methionine domain containing 2	10090	MGI:1929628	Inparanoid, OMA, EggNOG
Rat	65190	Rsad2	radical S-adenosyl methionine domain containing 2	10116	RGD:620495	Inparanoid, OMA, EggNOG
Dog	609005	RSAD2	radical S-adenosyl methionine domain containing 2	9615	VGNC:45770	Inparanoid, OMA, EggNOG
Horse	100072610	RSAD2	radical S-adenosyl methionine domain containing 2	9796	VGNC:22595	Inparanoid, OMA, EggNOG
Cow	506415	RSAD2	radical S-adenosyl methionine domain containing 2	9913	VGNC:34176	Inparanoid, OMA, EggNOG
Pig	396752	RSAD2	radical S-adenosyl methionine domain containing 2	9823		Inparanoid, OMA, EggNOG
Opossum		RSAD2	radical S-adenosyl methionine domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30908]	13616		Inparanoid, EggNOG
Platypus	100080030	RSAD2	radical S-adenosyl methionine domain containing 2	9258		Inparanoid, OMA, EggNOG
Chicken	428650	RSAD2	radical S-adenosyl methionine domain containing 2	9031	CGNC:12277	Inparanoid, OMA, EggNOG
Anole lizard	100565093	rsad2	radical S-adenosyl methionine domain containing 2	28377		Inparanoid, OMA, EggNOG
Xenopus	100493449	rsad2	radical S-adenosyl methionine domain containing 2	8364	XB-GENE-485892	Inparanoid, OMA, EggNOG
Zebrafish	570456	rsad2	radical S-adenosyl methionine domain containing 2	7955	ZDB-GENE-050913-129	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]