JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Radical S-adenosyl methionine domain-containing protein 2

Gene ID	91543
uniprot	Q8WXG1
Gene Name	RSAD2
Ensernbl ID	ENSP00000371471
Family	Belongs to the radical SAM superfamily. RSAD2 family.
Sequence	MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	91543	RSAD2	Radical S-adenosyl methionine domain-containing protein 2	Q8WXG1
MOUSE	58185	Rsad2	Radical S-adenosyl methionine domain-containing protein 2	Q8CBB9
MOUSE		Rsad2	Radical S-adenosyl methionine domain-containing protein 2	D6RJ49
MOUSE		Rsad2	Uncharacterized protein	Q3UAK4
RAT	65190	Rsad2	Radical S-adenosyl methionine domain-containing protein 2	O70600
RAT		Rsad2	RCG62278	A0A0H2UHF4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx