Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

SGK1

DescriptionSerine/threonine-protein kinase Sgk1

Gene and Protein Information

Gene ID6446
Uniprot Accession IDs B7UUP7 B7UUP8 B7UUP9 B7Z5B2 E1P583 Q5TCN2 Q5TCN3 Q5TCN4 Q5VY65 Q9UN56
Ensembl ID ENSP00000356832
Symbol SGK SGK
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Sequence
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463011SGK1serum/glucocorticoid regulated kinase 19598VGNC:11250OMA, EggNOG
Macaque713082SGK1serum/glucocorticoid regulated kinase 19544Inparanoid, OMA, EggNOG
Mouse20393Sgk1serum/glucocorticoid regulated kinase 110090MGI:1340062Inparanoid, OMA, EggNOG
Rat29517Sgk1serum/glucocorticoid regulated kinase 110116RGD:3668Inparanoid, OMA, EggNOG
Dog403647SGK1serum/glucocorticoid regulated kinase 19615VGNC:46097Inparanoid, OMA, EggNOG
HorseSGK1serum/glucocorticoid regulated kinase 1 [Source:HGNC Symbol;Acc:HGNC:10810]9796OMA, EggNOG
Cow515854SGK1serum/glucocorticoid regulated kinase 19913VGNC:34541Inparanoid, OMA, EggNOG
Pig100625739SGK1serum/glucocorticoid regulated kinase 19823Inparanoid, OMA, EggNOG
Opossum100025435SGK1serum/glucocorticoid regulated kinase 113616OMA, EggNOG
Platypus100073891SGK1serum/glucocorticoid regulated kinase 19258Inparanoid, OMA, EggNOG
Chicken395133SGK1serum/glucocorticoid regulated kinase 19031CGNC:49184Inparanoid, OMA, EggNOG
Anole lizard100565714sgk1serum/glucocorticoid regulated kinase 128377Inparanoid, OMA, EggNOG
Xenopus594981sgk1serum/glucocorticoid regulated kinase 18364XB-GENE-1003518Inparanoid, OMA, EggNOG
Zebrafish324140sgk1serum/glucocorticoid regulated kinase 17955ZDB-GENE-030131-2860Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    non-receptor serine/threonine protein kinase    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    transfer/carrier protein    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    protein kinase    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    calmodulin    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    transferase    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    annexin    /    Serine/threonine-protein kinase sgk1
protein    /    calcium-binding protein    /    kinase    /    Serine/threonine-protein kinase sgk1
DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    SGK family    /    Serine/threonine-protein kinase sgk1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.