The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 10927 |
|---|
| Uniprot Accession IDs | A8K0X6 B3KRQ4 Q7KZJ8 Q9GZT2 Q9H0N7 |
|---|
| Ensembl ID | ENSP00000365019 |
|---|
| Symbol | OCR SPIN SPIN TDRD24 |
|---|
| Family | Belongs to the SPIN/STSY family. |
|---|
| Sequence | MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
