JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Spindlin-1

Gene ID	10927
uniprot	Q9Y657
Gene Name	SPIN1
Ensernbl ID	ENSP00000365019
Family	Belongs to the SPIN/STSY family.
Sequence	MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10927	SPIN1	Spindlin-1	Q9Y657
MOUSE	20729	Spin1	Spindlin-1	Q61142
MOUSE		Spin1	Uncharacterized protein	Q3TQU6
MOUSE	20729	Spin1	Uncharacterized protein	Q3TLF7
MOUSE		Spin1	Uncharacterized protein	Q3UX91
MOUSE		Spin1	Uncharacterized protein	Q3TQU2
MOUSE		Spin1	Uncharacterized protein	Q3UWM7
RAT	361217	Spin1	Spindlin-1	Q4V8J7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx