The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 169981 |
|---|
| Uniprot Accession IDs | B2RUW3 B7Z8W2 Q8N5D9 |
|---|
| Ensembl ID | ENSP00000364054 |
|---|
| Symbol | SPIN-3 TDRD27 bA445O16.1 |
|---|
| Family | Belongs to the SPIN/STSY family. |
|---|
| Sequence | MKTPFGKAAAGQRSRTGAGHGSVSVTMIKRKAAHKKHRSRPTSQPRGNIVGCRIQHGWKDGDEPLTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELHRDERVSSLEVLPNRVASSRISDTHLAEIMVGKAVEHIFETEEGSKNEWRGMVLAQAPVMNTWFYITYEKDPVLYMYQLLDDYKDGDLRILQDSNDSPLAEREPGEVIDSLVGKQVEYAKDDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
