The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ribonuclease pancreatic
| Gene ID | 6035 |
|---|
| uniprot | P07998 |
|---|
| Gene Name | RNASE1 |
|---|
| Ensernbl ID | ENSP00000381057 |
|---|
| Family | Belongs to the pancreatic ribonuclease family. |
|---|
| Sequence | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6035 | RNASE1 | Ribonuclease pancreatic | P07998 |
| MOUSE | | Rnase1 | Ribonuclease pancreatic | P00683 |
| MOUSE | | Rnase1 | Ribonuclease, RNase A family, 1 (Pancreatic) | Q8K2T2 |
| MOUSE | 19752 | Rnase1 | Ribonuclease pancreatic | Q8C6G3 |
| RAT | 103690354 | Rnase1 | Ribonuclease pancreatic beta-type | P00684 |
| RAT | | Rnase1 | Ribonuclease pancreatic beta-type | A0A0A0MY25 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
