The store will not work correctly when cookies are disabled.
RNASE1
| Description | Ribonuclease pancreatic |
|---|
Gene and Protein Information
| Gene ID | 6035 |
|---|
| Uniprot Accession IDs | B2R589 D3DS06 Q16830 Q16869 Q1KHR2 Q6ICS5 Q9UCB4 Q9UCB5 |
|---|
| Ensembl ID | ENSP00000381057 |
|---|
| Symbol | RIB1 RNS1 RAC1 RIB1 RNS1 |
|---|
| Family | Belongs to the pancreatic ribonuclease family. |
|---|
| Sequence | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 465207 | RNASE1 | ribonuclease A family member 1, pancreatic | 9598 | VGNC:6798 | Inparanoid, OMA, EggNOG |
| Macaque | 704676 | RNASE1 | ribonuclease A family member 1, pancreatic | 9544 | | Inparanoid, OMA |
| Mouse | 19752 | Rnase1 | ribonuclease, RNase A family, 1 (pancreatic) | 10090 | MGI:97919 | Inparanoid, OMA, EggNOG |
| Dog | 475395 | LOC475395 | ribonuclease pancreatic-like | 9615 | | OMA, EggNOG |
| Horse | 100058995 | RNASE1 | ribonuclease A family member 1, pancreatic | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 280720 | BRB | brain ribonuclease | 9913 | | OMA, EggNOG |
| Cow | 280930 | RNASE1 | ribonuclease, RNase A family, 1 (pancreatic) | 9913 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
