Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

RORC

DescriptionNuclear receptor ROR-gamma

Gene and Protein Information

Gene ID6097
Uniprot Accession IDs Q5SZR9 Q8N5V7 Q8NCY8
Ensembl ID ENSP00000327025
Symbol NR1F3 RORG RZRG TOR RORG RZRG IMD42 NR1F3 RZR-GAMMA
FamilyBelongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457303RORCRAR related orphan receptor C9598VGNC:49010OMA, EggNOG
Macaque717052RORCRAR related orphan receptor C9544Inparanoid, OMA, EggNOG
Mouse19885RorcRAR-related orphan receptor gamma10090MGI:104856Inparanoid, OMA, EggNOG
Dog483205RORCRAR related orphan receptor C9615VGNC:45697Inparanoid, OMA, EggNOG
Horse100060134RORCRAR related orphan receptor C9796VGNC:22505Inparanoid, OMA, EggNOG
Cow527470RORCRAR related orphan receptor C9913VGNC:34090Inparanoid, OMA, EggNOG
Pig100622477RORCRAR related orphan receptor C9823Inparanoid, OMA, EggNOG
Opossum100019046RORCRAR related orphan receptor C13616Inparanoid, OMA, EggNOG
Anole lizard100567231rorcRAR related orphan receptor C28377Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Nuclear receptor    /    Retinoic acid-related orphans    /    Nuclear receptor ror-gamma

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      Immunodeficiency 420UniProt Disease
      psoriasis6696Expression AtlasMONDO:0005083
      IMMUNODEFICIENCY 421CTDMONDO:0014710
      Inflammation0CTD
      Sleep Disorders, Circadian Rhythm0CTD
      Inflammation0DisGeNET
      Delayed Sleep Phase Syndrome5DisGeNETMONDO:0024377
      Nonorganic Sleep Wake Cycle Disorders0DisGeNET
      Advanced Sleep Phase Syndrome5DisGeNETMONDO:0015609
      Non-24 Hour Sleep-Wake Disorder0DisGeNET

      Bibliography

      1.Villey, I I, de Chasseval, R R and de Villartay, J P JP. 1999-12 RORgammaT, a thymus-specific isoform of the orphan nuclear receptor RORgamma / TOR, is up-regulated by signaling through the pre-T cell receptor and binds to the TEA promoter. [PMID:10602018]
      2.Sun, Z Z and 7 more authors. 2000-06-30 Requirement for RORgamma in thymocyte survival and lymphoid organ development. [PMID:10875923]
      3.Kurebayashi, S S and 6 more authors. 2000-08-29 Retinoid-related orphan receptor gamma (RORgamma) is essential for lymphoid organogenesis and controls apoptosis during thymopoiesis. [PMID:10963675]
      4.Hartley, J L JL, Temple, G F GF and Brasch, M A MA. 2000-11 DNA cloning using in vitro site-specific recombination. [PMID:11076863]
      5.Wiemann, S S and 23 more authors. 2001-03 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. [PMID:11230166]
      6.Winoto, Astar A and Littman, Dan R DR. 2002-04 Nuclear hormone receptors in T lymphocytes. [PMID:11983153]
      7.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      8.Wang, Hua H and 5 more authors. 2003-07 Molecular screening and association studies of retinoid-related orphan receptor gamma (RORC): a positional and functional candidate for type 2 diabetes. [PMID:12855222]
      9.Ota, Toshio T and 156 more authors. 2004-01 Complete sequencing and characterization of 21,243 full-length human cDNAs. [PMID:14702039]
      10.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]