JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
SPIN4

SPIN4

Description	Spindlin-4

Gene and Protein Information

Gene ID	139886
Uniprot Accession IDs	B3KX90 Q5JUL2
Ensembl ID	ENSP00000334163
Symbol	TDRD28
Family	Belongs to the SPIN/STSY family.
Sequence	MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	106995225	SPIN4	spindlin family member 4	9544		Inparanoid, OMA
Mouse	270624	Spin4	spindlin family, member 4	10090	MGI:2444925	Inparanoid, OMA
Dog	480938	SPIN4	spindlin family member 4	9615	VGNC:46743	Inparanoid, OMA
Horse	100070371	SPIN4	spindlin family member 4	9796	VGNC:23522	Inparanoid, OMA
Cow	540146	SPIN4	spindlin family member 4	9913	VGNC:35218	Inparanoid, OMA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]