S100A4
| Description | Protein S100-A4 |
|---|
Gene and Protein Information
| Gene ID | 6275 |
|---|---|
| Uniprot Accession IDs | A8K7R8 D3DV46 Q6ICP8 |
| Ensembl ID | ENSP00000357705 |
| Symbol | CAPL MTS1 42A 18A2 CAPL FSP1 MTS1 P9KA PEL98 |
| Family | Belongs to the S-100 family. |
| Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457320 | S100A4 | S100 calcium binding protein A4 | 9598 | VGNC:1527 | OMA, EggNOG |
| Macaque | 715115 | S100A4 | S100 calcium binding protein A4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20198 | S100a4 | S100 calcium binding protein A4 | 10090 | MGI:1330282 | Inparanoid, OMA, EggNOG |
| Rat | 24615 | S100a4 | S100 calcium-binding protein A4 | 10116 | RGD:3245 | Inparanoid, OMA, EggNOG |
| Dog | 403787 | S100A4 | S100 calcium binding protein A4 | 9615 | VGNC:45830 | Inparanoid, OMA, EggNOG |
| Horse | 100056181 | S100A4 | S100 calcium binding protein A4 | 9796 | VGNC:22653 | Inparanoid, OMA, EggNOG |
| Cow | 282343 | S100A4 | S100 calcium binding protein A4 | 9913 | VGNC:34244 | Inparanoid, OMA, EggNOG |
| Pig | 100156358 | S100A4 | S100 calcium binding protein A4 | 9823 | OMA, EggNOG | |
| Opossum | 100014492 | LOC100014492 | protein S100-A4 | 13616 | OMA, EggNOG | |
| Platypus | 100093318 | S100A4 | S100 calcium binding protein A4 | 9258 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Protein S100-A4
protein / calcium-binding protein / growth factor / Protein S100-A4
protein / calcium-binding protein / calmodulin / Protein S100-A4
protein / calcium-binding protein / growth factor / Protein S100-A4
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A4
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|