Protein or Target Summary

Proton-coupled amino acid transporter 1

Gene ID	206358
uniprot	Q7Z2H8
Gene Name	SLC36A1
Ensernbl ID	ENSP00000243389
Family	Belongs to the amino acid/polyamine transporter 2 family.
Sequence	MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	206358	SLC36A1	Proton-coupled amino acid transporter 1	Q7Z2H8
MOUSE	215335	Slc36a1	Proton-coupled amino acid transporter 1	Q8K4D3
MOUSE		Slc36a1	Proton-coupled amino acid transporter 1	Q5F228
MOUSE	215335	Slc36a1	Slc36a1 protein	Q5F227
RAT	155205	Slc36a1	Proton-coupled amino acid transporter 1	Q924A5

Protein Classes

PANTHER Classes
protein / transporter / amino acid transporter / Proton-coupled amino acid transporter 1

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC36 family of proton-coupled amino acid transporters / Proton-coupled amino acid transporter 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx