The store will not work correctly when cookies are disabled.
SLC36A1
| Description | Proton-coupled amino acid transporter 1 |
|---|
Gene and Protein Information
| Gene ID | 206358 |
|---|
| Uniprot Accession IDs | C9JI34 Q1LZ56 Q7Z7C0 Q86YK4 Q96M74 Proton/amino acid transporter 1 |
|---|
| Ensembl ID | ENSP00000243389 |
|---|
| Symbol | PAT1 Dct1 PAT1 LYAAT1 TRAMD3 |
|---|
| Family | Belongs to the amino acid/polyamine transporter 2 family. |
|---|
| Sequence | MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471708 | SLC36A1 | solute carrier family 36 member 1 | 9598 | VGNC:8644 | OMA, EggNOG |
| Macaque | 713630 | SLC36A1 | solute carrier family 36 member 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 215335 | Slc36a1 | solute carrier family 36 (proton/amino acid symporter), member 1 | 10090 | MGI:2445299 | Inparanoid, OMA, EggNOG |
| Rat | 155205 | Slc36a1 | solute carrier family 36 member 1 | 10116 | RGD:619801 | Inparanoid, OMA, EggNOG |
| Dog | 489173 | SLC36A1 | solute carrier family 36 member 1 | 9615 | VGNC:46382 | Inparanoid, OMA, EggNOG |
| Horse | 100071523 | SLC36A1 | solute carrier family 36 member 1 | 9796 | VGNC:23180 | Inparanoid, OMA |
| Cow | 518759 | SLC36A1 | solute carrier family 36 member 1 | 9913 | VGNC:34838 | Inparanoid, OMA, EggNOG |
| Pig | 100514926 | SLC36A1 | solute carrier family 36 member 1 | 9823 | | Inparanoid, EggNOG |
| Anole lizard | 100553431 | LOC100553431 | proton-coupled amino acid transporter 1 | 28377 | | OMA, EggNOG |
| Xenopus | | slc36a1 | solute carrier family 36 (proton/amino acid symporter), member 1 [Source:Xenbase;Acc:XB-GENE-976345] | 8364 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
