| Description | Protein S100-A6 |
|---|
Gene and Protein Information
| Gene ID | 6277 |
|---|---|
| Uniprot Accession IDs | D3DV39 Q5RHS4 |
| Ensembl ID | ENSP00000357709 |
| Symbol | CACY 2A9 PRA 5B10 CABP CACY S10A6 |
| Family | Belongs to the S-100 family. |
| Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 738116 | S100A6 | S100 calcium binding protein A6 | 9598 | VGNC:1529 | OMA, EggNOG |
| Macaque | 715169 | S100A6 | S100 calcium binding protein A6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20200 | S100a6 | S100 calcium binding protein A6 (calcyclin) | 10090 | MGI:1339467 | Inparanoid, OMA, EggNOG |
| Rat | 85247 | S100a6 | S100 calcium binding protein A6 | 10116 | RGD:620264 | Inparanoid, OMA, EggNOG |
| Dog | 480143 | S100A6 | S100 calcium binding protein A6 | 9615 | VGNC:45832 | Inparanoid, OMA, EggNOG |
| Horse | 100033887 | S100A6 | S100 calcium binding protein A6 | 9796 | VGNC:22655 | Inparanoid, OMA, EggNOG |
| Pig | 733608 | S100A6 | S100 calcium binding protein A6 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019435 | LOC100019435 | protein S100-A6-like | 13616 | OMA, EggNOG | |
| Platypus | 100093336 | LOC100093336 | protein S100-A6 | 9258 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Protein S100-A6
protein / calcium-binding protein / signaling molecule / Protein S100-A6
protein / calcium-binding protein / calmodulin / Protein S100-A6
protein / calcium-binding protein / signaling molecule / Protein S100-A6
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A6
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|