S100A6 Protein - Human Target | Aladdin Scientific Research

Description	Protein S100-A6

Gene and Protein Information

Gene ID	6277
Uniprot Accession IDs	D3DV39 Q5RHS4
Ensembl ID	ENSP00000357709
Symbol	CACY 2A9 PRA 5B10 CABP CACY S10A6
Family	Belongs to the S-100 family.
Sequence	MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	738116	S100A6	S100 calcium binding protein A6	9598	VGNC:1529	OMA, EggNOG
Macaque	715169	S100A6	S100 calcium binding protein A6	9544		Inparanoid, OMA, EggNOG
Mouse	20200	S100a6	S100 calcium binding protein A6 (calcyclin)	10090	MGI:1339467	Inparanoid, OMA, EggNOG
Rat	85247	S100a6	S100 calcium binding protein A6	10116	RGD:620264	Inparanoid, OMA, EggNOG
Dog	480143	S100A6	S100 calcium binding protein A6	9615	VGNC:45832	Inparanoid, OMA, EggNOG
Horse	100033887	S100A6	S100 calcium binding protein A6	9796	VGNC:22655	Inparanoid, OMA, EggNOG
Pig	733608	S100A6	S100 calcium binding protein A6	9823		Inparanoid, OMA, EggNOG
Opossum	100019435	LOC100019435	protein S100-A6-like	13616		OMA, EggNOG
Platypus	100093336	LOC100093336	protein S100-A6	9258		OMA, EggNOG

Protein Classes

PANTHER Classes
protein / calcium-binding protein / calmodulin / Protein S100-A6
protein / calcium-binding protein / signaling molecule / Protein S100-A6

DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Related active small molecules

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source