JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

R-spondin-2

Gene ID	340419
uniprot	Q6UXX9
Gene Name	RSPO2
Ensernbl ID	ENSP00000276659
Family	Belongs to the R-spondin family.
Sequence	MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	340419	RSPO2	R-spondin-2	Q6UXX9
MOUSE	239405	Rspo2	R-spondin-2	Q8BFU0
RAT	500863	Rspo2	R-spondin 2	I7GAZ6
RAT	500863	Rspo2	R-spondin 2	D3ZCB0
RAT	500863	Rspo2	R-spondin 2	A0A0G2K155

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx