Protein or Target Summary
Ubiquitin-60S ribosomal protein L40
| Gene ID | 7311 |
|---|---|
| uniprot | P62987 |
| Gene Name | UBA52 |
| Ensernbl ID | ENSP00000388107 |
| Family | In the C-terminal section; belongs to the eukaryotic ribosomal protein eL40 family. |
| Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 7311 | UBA52 | Ubiquitin-60S ribosomal protein L40 | P62987 |
| MOUSE | Uba52 | Ubiquitin A-52 residue ribosomal protein fusion product 1 | B0LAC2 | |
| MOUSE | Uba52 | Ubiquitin-60S ribosomal protein L40 | E9Q9J0 | |
| MOUSE | 22186 | Uba52 | MCG23116, isoform CRA_a | Q5M9K3 |
| MOUSE | 22186 | Uba52 | Ubiquitin-60S ribosomal protein L40 | P62984 |
| RAT | 64156 | Uba52 | Ubiquitin A-52 residue ribosomal protein fusion product 1 | Q6P7R7 |
| RAT | 64156 | Uba52 | Ubiquitin-60S ribosomal protein L40 | P62986 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / ribosomal protein / Ubiquitin-60S ribosomal protein L40
protein / nucleic acid binding / ribosomal protein / Ubiquitin-60S ribosomal protein L40
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Ubiquitin-60S ribosomal protein L40
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Ubiquitin-60S ribosomal protein L40
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx