JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Gap junction gamma-3 protein

Gene ID	349149
uniprot	Q8NFK1
Gene Name	GJC3
Ensernbl ID	ENSP00000325775
Family	Belongs to the connexin family. Gamma-type subfamily.
Sequence	MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	349149	GJC3	Gap junction gamma-3 protein	Q8NFK1
MOUSE	118446	Gjc3	Gap junction gamma-3 protein	Q921C1
RAT		Gjc3	Gap junction protein	F1LPT0

Protein Classes

PANTHER Classes
protein / cell junction protein / gap junction / Gap junction gamma-3 protein

DTO Classes
protein / Cell-cell junction / Gap junction / Gap junction gamma-3 protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx