The store will not work correctly when cookies are disabled.
GJC3
| Description | Gap junction gamma-3 protein |
|---|
Gene and Protein Information
| Gene ID | 349149 |
|---|
| Uniprot Accession IDs | A4D296 Q86XI9 |
|---|
| Ensembl ID | ENSP00000325775 |
|---|
| Symbol | GJE1 CX29 GJE1 CX30.2 CX31.3 |
|---|
| Family | Belongs to the connexin family. Gamma-type subfamily. |
|---|
| Sequence | MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737656 | GJC3 | gap junction protein gamma 3 | 9598 | VGNC:14017 | OMA, EggNOG |
| Macaque | 100424576 | LOC100424576 | gap junction gamma-3 protein | 9544 | | OMA, EggNOG |
| Mouse | 118446 | Gjc3 | gap junction protein, gamma 3 | 10090 | MGI:2153041 | Inparanoid, OMA, EggNOG |
| Rat | 288529 | Gjc3 | gap junction protein, gamma 3 | 10116 | RGD:727930 | Inparanoid, OMA, EggNOG |
| Dog | 489850 | GJC3 | gap junction protein gamma 3 | 9615 | VGNC:54027 | Inparanoid, OMA, EggNOG |
| Horse | 100068490 | GJC3 | gap junction protein gamma 3 | 9796 | VGNC:18361 | Inparanoid, OMA, EggNOG |
| Cow | 539991 | GJC3 | gap junction protein gamma 3 | 9913 | VGNC:29384 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
