The store will not work correctly when cookies are disabled.
CCL4
| Description | C-C motif chemokine 4 |
|---|
Gene and Protein Information
| Gene ID | 6351 |
|---|
| Uniprot Accession IDs | P22617 Q13704 Q3SXL8 Q6FGI8 |
|---|
| Ensembl ID | ENSP00000482259 |
|---|
| Symbol | LAG1 MIP1B SCYA4 ACT2 G-26 HC21 LAG1 LAG-1 MIP1B SCYA2 SCYA4 MIP1B1 AT744.1 MIP-1-beta |
|---|
| Family | Belongs to the intercrine beta (chemokine CC) family. |
|---|
| Sequence | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Rat | 116637 | Ccl4 | C-C motif chemokine ligand 4 | 10116 | RGD:620441 | Inparanoid, OMA |
| Opossum | 100017283 | LOC100017283 | C-C motif chemokine 4-like | 13616 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
