CD79B
| Description | B-cell antigen receptor complex-associated protein beta chain |
|---|
Gene and Protein Information
| Gene ID | 974 |
|---|---|
| Uniprot Accession IDs | Q53FS2 Q9BU06 |
| Ensembl ID | ENSP00000376544 |
| Symbol | B29 IGB B29 IGB AGM6 |
| Sequence | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454773 | CD79B | CD79b molecule | 9598 | VGNC:9180 | OMA, EggNOG |
| Mouse | 15985 | Cd79b | CD79B antigen | 10090 | MGI:96431 | Inparanoid, OMA, EggNOG |
| Rat | 171055 | Cd79b | CD79b molecule | 10116 | RGD:620012 | Inparanoid, OMA, EggNOG |
| Dog | 609449 | CD79B | CD79b molecule | 9615 | VGNC:38974 | Inparanoid, OMA, EggNOG |
| Cow | 509801 | CD79B | CD79b molecule | 9913 | VGNC:27047 | Inparanoid, OMA, EggNOG |
| Pig | 100511898 | CD79B | CD79b molecule | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100026330 | CD79B | CD79b molecule | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 419940 | CD79B | CD79b molecule | 9031 | CGNC:147 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / immunoglobulin receptor superfamily / B-cell antigen receptor complex-associated protein beta chain
protein / receptor / defense/immunity protein / B-cell antigen receptor complex-associated protein beta chain
protein / receptor / cytokine receptor / B-cell antigen receptor complex-associated protein beta chain
protein / receptor / immunoglobulin receptor superfamily / B-cell antigen receptor complex-associated protein beta chain
protein / receptor / defense/immunity protein / B-cell antigen receptor complex-associated protein beta chain
protein / receptor / cytokine receptor / B-cell antigen receptor complex-associated protein beta chain
DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / B-cell antigen receptor complex-associated protein beta chain
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / B-cell antigen receptor complex-associated protein beta chain
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|