| Description | DNA-directed RNA polymerases I, II, and III subunit RPABC1 |
|---|
Gene and Protein Information
| Gene ID | 5434 |
|---|---|
| Uniprot Accession IDs | B2R6L4 D6W5Y1 O43380 Q6PIH5 Q9BT06 RNA polymerases I, II, and III subunit ABC1 |
| Ensembl ID | ENSP00000478303 |
| Symbol | RPB5 XAP4 RPABC1 hRPB25 hsRPB5 |
| Family | Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family. |
| Sequence | MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456359 | POLR2E | RNA polymerase II subunit E | 9598 | OMA, EggNOG | |
| Macaque | 721178 | POLR2E | RNA polymerase II subunit E | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66420 | Polr2e | polymerase (RNA) II (DNA directed) polypeptide E | 10090 | MGI:1913670 | Inparanoid, OMA, EggNOG |
| Rat | 690966 | Polr2e | RNA polymerase II subunit E | 10116 | RGD:1589817 | Inparanoid, OMA, EggNOG |
| Dog | 611859 | POLR2E | RNA polymerase II subunit E | 9615 | VGNC:44796 | Inparanoid, OMA, EggNOG |
| Horse | 100065431 | POLR2E | RNA polymerase II subunit E | 9796 | VGNC:21677 | Inparanoid, OMA, EggNOG |
| Cow | 512971 | POLR2E | RNA polymerase II subunit E | 9913 | VGNC:33139 | Inparanoid, OMA, EggNOG |
| Pig | 100623333 | POLR2E | RNA polymerase II subunit E | 9823 | OMA, EggNOG | |
| Opossum | 100015794 | POLR2E | RNA polymerase II subunit E | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 420103 | POLR2E | RNA polymerase II subunit E | 9031 | CGNC:1864 | Inparanoid, OMA, EggNOG |
| Xenopus | 549227 | polr2e | polymerase (RNA) II (DNA directed) polypeptide E, 25kDa | 8364 | XB-GENE-1005304 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445170 | polr2eb | polymerase (RNA) II (DNA directed) polypeptide E, b | 7955 | ZDB-GENE-040801-83 | Inparanoid, OMA, EggNOG |
| C. elegans | 172412 | rpb-5 | DNA-directed RNA polymerases I, II, and III subunit RPABC1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36160 | Rpb5 | CG11979 gene product from transcript CG11979-RB | 7227 | FBgn0033571 | Inparanoid, EggNOG |
| S.cerevisiae | 852451 | RPB5 | DNA-directed RNA polymerase core subunit RPB5 | 4932 | S000000358 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|