Protein or Target Summary
DNA-directed RNA polymerases I, II, and III subunit RPABC1
| Gene ID | 5434 |
|---|---|
| uniprot | P19388 |
| Gene Name | POLR2E |
| Ensernbl ID | ENSP00000478303 |
| Family | Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family. |
| Sequence | MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5434 | POLR2E | DNA-directed RNA polymerases I, II, and III subunit RPABC1 | P19388 |
| MOUSE | 66420 | Polr2e | DNA-directed RNA polymerases I, II, and III subunit RPABC1 | Q80UW8 |
| MOUSE | Polr2e | Uncharacterized protein | Q3U2B9 | |
| MOUSE | Polr2e | Polr2e protein | Q8R0H0 | |
| MOUSE | 66420 | Polr2e | MCG13422, isoform CRA_a | Q3V214 |
| MOUSE | Polr2e | MCG13422, isoform CRA_c | Q8CI23 | |
| RAT | 690966 | Polr2e | DNA-directed RNA polymerases I, II, and III subunit RPABC1 | B0BNE2 |
| RAT | Polr2e | DNA-directed RNA polymerases I, II, and III subunit RPABC1 | A0A1W2Q620 | |
| RAT | 690966 | Polr2e | DNA-directed RNA polymerases I, II, and III subunit RPABC1 | A0A1W2Q690 |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx