JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

CAMPATH-1 antigen

Gene ID	1043
uniprot	P31358
Gene Name	CD52
Ensernbl ID	ENSP00000363330
Sequence	MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1043	CD52	CAMPATH-1 antigen	P31358
MOUSE	23833	Cd52	CAMPATH-1 antigen	Q64389
MOUSE	23833	Cd52	Uncharacterized protein	Q3U1T8
RAT	117054	Cd52	CAMPATH-1 antigen	Q63064
RAT		Cd52	CD52 antigen	G3V7Y5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx