The store will not work correctly when cookies are disabled.
CD52
| Description | CAMPATH-1 antigen |
|---|
Gene and Protein Information
| Gene ID | 1043 |
|---|
| Uniprot Accession IDs | Q5T138 Q9BW46 |
|---|
| Ensembl ID | ENSP00000363330 |
|---|
| Symbol | CDW52 HE5 HE5 CDW52 EDDM5 |
|---|
| Sequence | MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736829 | CD52 | CD52 molecule | 9598 | VGNC:5012 | OMA, EggNOG |
| Macaque | 714429 | CD52 | CD52 molecule | 9544 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
