The store will not work correctly when cookies are disabled.
POLR1C
| Description | DNA-directed RNA polymerases I and III subunit RPAC1 |
|---|
Gene and Protein Information
| Gene ID | 9533 |
|---|
| Uniprot Accession IDs | O75395 Q5JTE3 DNA-directed RNA polymerase I subunit C |
|---|
| Ensembl ID | ENSP00000361465 |
|---|
| Symbol | POLR1E AC40 RPA5 TCS3 HLD11 RPA39 RPA40 RPAC1 RPC40 |
|---|
| Family | Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family. |
|---|
| Sequence | MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736609 | POLR1C | RNA polymerase I and III subunit C | 9598 | VGNC:8725 | OMA, EggNOG |
| Macaque | 700727 | POLR1C | RNA polymerase I subunit C | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20016 | Polr1c | polymerase (RNA) I polypeptide C | 10090 | MGI:103288 | Inparanoid, OMA, EggNOG |
| Rat | 301246 | Polr1c | RNA polymerase I and III subunit C | 10116 | RGD:1309689 | Inparanoid, OMA, EggNOG |
| Dog | 474912 | POLR1C | RNA polymerase I and III subunit C | 9615 | VGNC:44790 | Inparanoid, OMA, EggNOG |
| Horse | 100055372 | POLR1C | RNA polymerase I and III subunit C | 9796 | VGNC:21670 | Inparanoid, OMA, EggNOG |
| Cow | 516337 | POLR1C | RNA polymerase I and III subunit C | 9913 | VGNC:33133 | Inparanoid, OMA, EggNOG |
| Opossum | 100011139 | POLR1C | RNA polymerase I subunit C | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100084895 | POLR1C | RNA polymerase I subunit C | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 421452 | POLR1C | RNA polymerase I subunit C | 9031 | CGNC:7876 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555051 | polr1c | RNA polymerase I subunit C | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100379802 | polr1c | RNA polymerase I and III subunit C | 8364 | XB-GENE-1009901 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393538 | polr1c | RNA polymerase I and III subunit C | 7955 | ZDB-GENE-040426-1495 | Inparanoid, OMA, EggNOG |
| C. elegans | 178823 | rpac-40 | RNA Polymerase I/III (A/C) shared subunit | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 33712 | CG3756 | CG3756 gene product from transcript CG3756-RA | 7227 | FBgn0031657 | Inparanoid, EggNOG |
| S.cerevisiae | 856226 | RPC40 | DNA-directed RNA polymerase core subunit RPC40 | 4932 | S000006314 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
