Protein or Target Summary

DNA-directed RNA polymerases I and III subunit RPAC1

Gene ID	9533
uniprot	O15160
Gene Name	POLR1C
Ensernbl ID	ENSP00000361465
Family	Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.
Sequence	MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9533	POLR1C	DNA-directed RNA polymerases I and III subunit RPAC1	O15160
MOUSE	20016	Polr1c	DNA-directed RNA polymerases I and III subunit RPAC1	P52432
MOUSE		Polr1c	Polr1c protein	A1L3C2
MOUSE		Polr1c	DNA-directed RNA polymerases I and III subunit RPAC1	G3UX92
MOUSE		Polr1c	DNA-directed RNA polymerases I and III subunit RPAC1	D3Z3D6
MOUSE		Polr1c	DNA-directed RNA polymerases I and III subunit RPAC1	G3UXX5
MOUSE		Polr1c	DNA-directed RNA polymerases I and III subunit RPAC1	D3Z7Q8
RAT		Polr1c	RNA polymerase I and III subunit C	A0A0G2K5T6
RAT	301246	Polr1c	Polymerase (RNA) I polypeptide C	Q5RJK9

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I and III subunit RPAC1

DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I and III subunit RPAC1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx