The store will not work correctly when cookies are disabled.
SULT1C2
| Description | Sulfotransferase 1C2 |
|---|
Gene and Protein Information
| Gene ID | 6819 |
|---|
| Uniprot Accession IDs | B2R813 Q53SG4 ST1C2 |
|---|
| Ensembl ID | ENSP00000319622 |
|---|
| Symbol | SULT1C1 ST1C1 ST1C2 SULT1C1 humSULTC2 |
|---|
| Family | Belongs to the sulfotransferase 1 family. |
|---|
| Sequence | MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 470470 | SULT1C2 | sulfotransferase family 1C member 2 | 9598 | VGNC:10778 | OMA, EggNOG |
| Macaque | 693398 | SULT1C2 | sulfotransferase family 1C member 2 | 9544 | | OMA, EggNOG |
| Mouse | 69083 | Sult1c2 | sulfotransferase family, cytosolic, 1C, member 2 | 10090 | MGI:1916333 | Inparanoid, OMA, EggNOG |
| Rat | 316153 | Sult1c2a | sulfotransferase family, cytosolic, 1C, member 2a | 10116 | RGD:1305885 | Inparanoid, OMA |
| Rat | 100910526 | LOC100910526 | sulfotransferase 1C2-like | 10116 | RGD:6497849 | OMA, EggNOG |
| Dog | 474543 | SULT1C2 | sulfotransferase family 1C member 2 | 9615 | VGNC:46977 | Inparanoid, OMA, EggNOG |
| Horse | 100060302 | SULT1C2 | sulfotransferase family 1C member 2 | 9796 | VGNC:51407 | Inparanoid, OMA, EggNOG |
| Cow | 523898 | SULT1C2 | sulfotransferase family, cytosolic, 1C, member 2 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100623541 | LOC100623541 | sulfotransferase 1C2 | 9823 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100145082 | LOC100145082 | uncharacterized LOC100145082 | 8364 | | OMA, EggNOG |
| Zebrafish | 791732 | sult1st2 | sulfotransferase family 1, cytosolic sulfotransferase 2 | 7955 | ZDB-GENE-030804-27 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
