The store will not work correctly when cookies are disabled.
Protein or Target Summary
Sulfotransferase 1A1
| Gene ID | 6817 |
|---|
| uniprot | P50225 |
|---|
| Gene Name | SULT1A1 |
|---|
| Ensernbl ID | ENSP00000378972 |
|---|
| Family | Belongs to the sulfotransferase 1 family. |
|---|
| Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6817 | SULT1A1 | Sulfotransferase 1A1 | P50225 |
| MOUSE | | Sult1a1 | Sulfotransferase 1A1 | P52840 |
| MOUSE | | Sult1a1 | Sulfotransferase | D3Z2P8 |
| MOUSE | | Sult1a1 | Sulfotransferase | D3Z3G5 |
| MOUSE | | Sult1a1 | Sulfotransferase | E9QNL5 |
| MOUSE | 20887 | Sult1a1 | Sulfotransferase | Q91W19 |
| RAT | 83783 | Sult1a1 | Sulfotransferase 1A1 | P17988 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
