The store will not work correctly when cookies are disabled.
SUMO2
Description | Small ubiquitin-related modifier 2 |
---|
Gene and Protein Information
Gene ID | 6613 |
Uniprot Accession IDs | B2R4I2 P55855 Q32Q42 Q6IPZ6 Q96HK1 SUMO-2 |
Ensembl ID | ENSP00000405965 |
Symbol | SMT3B SMT3H2 HSMT3 SMT3B SUMO3 Smt3A SMT3H2 |
Family | Belongs to the ubiquitin family. SUMO subfamily. |
Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 454875 | SUMO2 | small ubiquitin-like modifier 2 | 9598 | VGNC:51740 | OMA, EggNOG |
Mouse | 170930 | Sumo2 | small ubiquitin-like modifier 2 | 10090 | MGI:2158813 | Inparanoid, OMA |
Mouse | 20610 | Sumo3 | small ubiquitin-like modifier 3 | 10090 | MGI:1336201 | OMA, EggNOG |
Rat | 690244 | Sumo2 | small ubiquitin-like modifier 2 | 10116 | RGD:621761 | Inparanoid, OMA |
Rat | 499417 | Sumo3 | small ubiquitin-like modifier 3 | 10116 | RGD:1561022 | OMA, EggNOG |
Dog | 474963 | SUMO2 | small ubiquitin-like modifier 2 | 9615 | | Inparanoid, OMA |
Cow | 617236 | SUMO3 | small ubiquitin-like modifier 3 | 9913 | | OMA, EggNOG |
Pig | 397044 | SUMO2 | small ubiquitin-like modifier 2 | 9823 | | Inparanoid, OMA |
Opossum | 100023068 | SUMO2 | small ubiquitin-like modifier 2 | 13616 | | OMA, EggNOG |
Platypus | 100087821 | LOC100087821 | small ubiquitin-related modifier 3 | 9258 | | OMA, EggNOG |
Chicken | 770125 | SUMO2 | small ubiquitin-like modifier 2 | 9031 | CGNC:55792 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|