The store will not work correctly when cookies are disabled.
STAMBP
Description | STAM-binding protein |
---|
Gene and Protein Information
Gene ID | 10617 |
Uniprot Accession IDs | B5M0B6 D6W5H7 Q3MJE7 |
Ensembl ID | ENSP00000377633 |
Symbol | AMSH AMSH MICCAP |
Family | Belongs to the peptidase M67C family. |
Sequence | MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 739448 | STAMBP | STAM binding protein | 9598 | VGNC:384 | OMA, EggNOG |
Macaque | 714562 | STAMBP | STAM binding protein | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 70527 | Stambp | STAM binding protein | 10090 | MGI:1917777 | Inparanoid, OMA, EggNOG |
Rat | 171565 | Stambp | Stam binding protein | 10116 | RGD:619963 | Inparanoid, OMA, EggNOG |
Horse | 100049814 | STAMBP | STAM binding protein | 9796 | VGNC:23652 | Inparanoid, OMA, EggNOG |
Cow | 532672 | STAMBP | STAM binding protein | 9913 | VGNC:35356 | Inparanoid, OMA, EggNOG |
Pig | 100516729 | STAMBP | STAM binding protein | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | | STAMBP | STAM binding protein [Source:HGNC Symbol;Acc:HGNC:16950] | 13616 | | Inparanoid, EggNOG |
Anole lizard | 100553341 | stambp | STAM binding protein | 28377 | | Inparanoid, OMA |
Xenopus | 100145287 | stambp | STAM binding protein | 8364 | XB-GENE-5926871 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|