Protein or Target Summary

STAM-binding protein

Gene ID	10617
uniprot	O95630
Gene Name	STAMBP
Ensernbl ID	ENSP00000377633
Family	Belongs to the peptidase M67C family.
Sequence	MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10617	STAMBP	STAM-binding protein	O95630
MOUSE		Stambp	Uncharacterized protein	Q3TGB1
MOUSE		Stambp	MKIAA4198 protein	Q5DTH9
MOUSE	70527	Stambp	STAM-binding protein	Q9CQ26
RAT	171565	Stambp	STAM-binding protein	Q8R424

Protein Classes

PANTHER Classes
protein / signaling molecule / cytokine / STAM-binding protein
protein / signaling molecule / metalloprotease / STAM-binding protein

DTO Classes
protein / Enzyme / Protease / Metalloprotease / STAM-binding protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx