JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
SPR

SPR

Description	Sepiapterin reductase

Gene and Protein Information

Gene ID	6697
Uniprot Accession IDs	A8K741 D6W5H2 Q53GI9 Q9UBB1 SPR
Ensembl ID	ENSP00000234454
Symbol	SDR38C1
Family	Belongs to the sepiapterin reductase family.
Sequence	MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	705317	SPR	sepiapterin reductase	9544		Inparanoid, OMA, EggNOG
Mouse	20751	Spr	sepiapterin reductase	10090	MGI:103078	Inparanoid, OMA, EggNOG
Rat	29270	Spr	sepiapterin reductase	10116	RGD:3753	Inparanoid, OMA, EggNOG
Dog	483118	SPR	sepiapterin reductase	9615	VGNC:49109	Inparanoid, OMA, EggNOG
Cow	533836	SPR	sepiapterin reductase	9913		Inparanoid, OMA, EggNOG
Pig	100521367	SPR	sepiapterin reductase	9823		OMA, EggNOG
Chicken	425255	SPR	sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)	9031	CGNC:32	Inparanoid, OMA, EggNOG
Anole lizard		SPR	sepiapterin reductase [Source:HGNC Symbol;Acc:HGNC:11257]	28377		Inparanoid, OMA, EggNOG
Zebrafish	554136	spra	sepiapterin reductase a	7955	ZDB-GENE-050522-412	OMA, EggNOG
Zebrafish	795445	sprb	sepiapterin reductase b	7955	ZDB-GENE-070719-1	Inparanoid, OMA
Fruitfly	31781	Sptr	Sepiapterin reductase	7227	FBgn0014032	Inparanoid, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]