Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

SSTR2

DescriptionSomatostatin receptor type 2

Gene and Protein Information

Gene ID6752
Uniprot Accession IDs A8K3Y0 B2R9P7 Q4VBP0 Q96GE0 Q96TF2 Q9BWH1 SS-2-R
Ensembl ID ENSP00000350198
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque695526SSTR2somatostatin receptor 29544Inparanoid, OMA, EggNOG
Mouse20606Sstr2somatostatin receptor 210090MGI:98328Inparanoid, OMA, EggNOG
Rat54305Sstr2somatostatin receptor 210116RGD:3763Inparanoid, OMA, EggNOG
Dog403472SSTR2somatostatin receptor 29615VGNC:46844Inparanoid, OMA, EggNOG
Horse100052744SSTR2somatostatin receptor 29796VGNC:23621Inparanoid, OMA, EggNOG
Cow282083SSTR2somatostatin receptor 29913VGNC:35326Inparanoid, OMA, EggNOG
PigSSTR2somatostatin receptor 2 [Source:HGNC Symbol;Acc:HGNC:11331]9823Inparanoid, OMA, EggNOG
Opossum100028527SSTR2somatostatin receptor 213616Inparanoid, OMA, EggNOG
Platypus100090283SSTR2somatostatin receptor 29258Inparanoid, OMA, EggNOG
Anole lizard100563000sstr2somatostatin receptor 228377Inparanoid, OMA
Xenopus100496382sstr2somatostatin receptor 28364XB-GENE-953419Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Somatostatin receptor type 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Somatostatin receptor type 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.