JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Tumor necrosis factor receptor superfamily member 13B

Gene ID	23495
uniprot	O14836
Gene Name	TNFRSF13B
Ensernbl ID	ENSP00000261652
Sequence	MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	23495	TNFRSF13B	Tumor necrosis factor receptor superfamily member 13B	O14836
MOUSE	57916	Tnfrsf13b	Tumor necrosis factor receptor superfamily member 13B	Q9ET35
MOUSE		Tnfrsf13b	Tumor necrosis factor receptor superfamily, member 13b	A5D8Y7
MOUSE		Tnfrsf13b	Tumor necrosis factor receptor superfamily member 13B	B1ATI4
MOUSE		Tnfrsf13b	Tumor necrosis factor receptor superfamily member 13B	B1ATI3
MOUSE		Tnfrsf13b	Uncharacterized protein	Q3U2P4
MOUSE	57916	Tnfrsf13b	Tumor necrosis factor receptor superfamily, member 13b	A5D8Y6
RAT		Tnfrsf13b	TNF receptor superfamily member 13B	F1LX35

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx