The store will not work correctly when cookies are disabled.
SULT1A2
| Description | Sulfotransferase 1A2 |
|---|
Gene and Protein Information
| Gene ID | 6799 |
|---|
| Uniprot Accession IDs | A9QY25 P78393 Q14CJ7 ST1A2 |
|---|
| Ensembl ID | ENSP00000378992 |
|---|
| Symbol | STP2 STP2 HAST4 P-PST ST1A2 TSPST2 P-PST 2 |
|---|
| Family | Belongs to the sulfotransferase 1 family. |
|---|
| Sequence | MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
