The store will not work correctly when cookies are disabled.
SULT1B1
| Description | Sulfotransferase family cytosolic 1B member 1 |
|---|
Gene and Protein Information
| Gene ID | 27284 |
|---|
| Uniprot Accession IDs | O15497 Q96FI1 Q9UK34 ST1B1 |
|---|
| Ensembl ID | ENSP00000308770 |
|---|
| Symbol | ST1B2 SULT1B2 ST1B1 ST1B2 SULT1B2 |
|---|
| Family | Belongs to the sulfotransferase 1 family. |
|---|
| Sequence | MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471216 | SULT1B1 | sulfotransferase family 1B member 1 | 9598 | VGNC:12845 | OMA, EggNOG |
| Macaque | 708638 | SULT1B1 | sulfotransferase family 1B member 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 56362 | Sult1b1 | sulfotransferase family 1B, member 1 | 10090 | MGI:2136282 | Inparanoid, OMA, EggNOG |
| Rat | 64305 | Sult1b1 | sulfotransferase family 1B member 1 | 10116 | RGD:708534 | Inparanoid, OMA |
| Dog | 403636 | SULT1B1 | sulfotransferase family 1B member 1 | 9615 | VGNC:46976 | Inparanoid, OMA |
| Cow | 521920 | SULT1B1 | sulfotransferase family 1B member 1 | 9913 | VGNC:53777 | Inparanoid, OMA |
| Opossum | 100010054 | LOC100010054 | sulfotransferase family cytosolic 1B member 1-like | 13616 | | Inparanoid, OMA |
| Platypus | 100078853 | SULT1B1 | sulfotransferase family 1B member 1 | 9258 | | Inparanoid, OMA |
| Chicken | 395227 | SULT1B1 | sulfotransferase family cytosolic 1B member 1 | 9031 | CGNC:49221 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
