The store will not work correctly when cookies are disabled.
Protein or Target Summary
Sulfotransferase family cytosolic 1B member 1
| Gene ID | 27284 |
|---|
| uniprot | O43704 |
|---|
| Gene Name | SULT1B1 |
|---|
| Ensernbl ID | ENSP00000308770 |
|---|
| Family | Belongs to the sulfotransferase 1 family. |
|---|
| Sequence | MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 27284 | SULT1B1 | Sulfotransferase family cytosolic 1B member 1 | O43704 |
| MOUSE | 56362 | Sult1b1 | Sulfotransferase family cytosolic 1B member 1 | Q9QWG7 |
| RAT | 64305 | Sult1b1 | Sulfotransferase family cytosolic 1B member 1 | P52847 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
