The store will not work correctly when cookies are disabled.
Protein or Target Summary
Estrogen sulfotransferase
| Gene ID | 6783 |
|---|
| uniprot | P49888 |
|---|
| Gene Name | SULT1E1 |
|---|
| Ensernbl ID | ENSP00000226444 |
|---|
| Family | Belongs to the sulfotransferase 1 family. |
|---|
| Sequence | MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6783 | SULT1E1 | Estrogen sulfotransferase | P49888 |
| MOUSE | | Sult1e1 | Estrogen sulfotransferase, testis isoform | P49891 |
| MOUSE | | Sult1e1 | Sulfotransferase | Q8JZX7 |
| MOUSE | 20860 | Sult1e1 | Sulfotransferase | Q9D566 |
| RAT | | Sult1e1 | Estrogen sulfotransferase, isoform 1 | P52844 |
| RAT | 360268 | Sult1e1 | Sulfotransferase | Q99ND5 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
