SPARC

Description	SPARC

Gene and Protein Information

Gene ID	6678
Uniprot Accession IDs	D3DQH9 Q6IBK4
Ensembl ID	ENSP00000231061
Symbol	ON ON OI17 BM-40
Family	Belongs to the SPARC family.
Sequence	MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	471709	SPARC	secreted protein acidic and cysteine rich	9598	VGNC:7154	OMA, EggNOG
Macaque	712388	SPARC	secreted protein acidic and cysteine rich	9544		Inparanoid, OMA, EggNOG
Mouse	20692	Sparc	secreted acidic cysteine rich glycoprotein	10090	MGI:98373	Inparanoid, OMA, EggNOG
Rat	24791	Sparc	secreted protein acidic and cysteine rich	10116	RGD:3742	Inparanoid, OMA, EggNOG
Dog	100855736	SPARC	secreted protein acidic and cysteine rich	9615	VGNC:46701	Inparanoid, OMA, EggNOG
Horse	100060119	SPARC	secreted protein acidic and cysteine rich	9796	VGNC:23478	Inparanoid, OMA, EggNOG
Cow	282077	SPARC	secreted protein acidic and cysteine rich	9913	VGNC:35171	Inparanoid, OMA, EggNOG
Opossum	100024756	SPARC	secreted protein acidic and cysteine rich	13616		Inparanoid, EggNOG
Platypus	100075328	SPARC	secreted protein acidic and cysteine rich	9258		Inparanoid, OMA, EggNOG
Chicken	386571	SPARC	secreted protein acidic and cysteine rich	9031	CGNC:3072	Inparanoid, OMA
Anole lizard	100554604	sparc	secreted protein acidic and cysteine rich	28377		Inparanoid, OMA, EggNOG
Xenopus	394973	sparc	secreted protein, acidic, cysteine-rich (osteonectin)	8364	XB-GENE-1009630	Inparanoid, OMA, EggNOG
Zebrafish	321357	sparc	secreted protein, acidic, cysteine-rich (osteonectin)	7955	ZDB-GENE-030131-9	Inparanoid, OMA
C. elegans	176931	ost-1	OSTeonectin (SPARC) related	6239		Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    extracellular matrix protein    /    cell adhesion molecule    /    SPARC
protein    /    extracellular matrix protein    /    extracellular matrix glycoprotein    /    SPARC
protein    /    extracellular matrix protein    /    growth factor    /    SPARC

DTO Classes
protein / Signaling / Growth factor / SPARC

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]