The store will not work correctly when cookies are disabled.
SPARC
Gene and Protein Information
| Gene ID | 6678 |
|---|
| Uniprot Accession IDs | D3DQH9 Q6IBK4 |
|---|
| Ensembl ID | ENSP00000231061 |
|---|
| Symbol | ON ON OI17 BM-40 |
|---|
| Family | Belongs to the SPARC family. |
|---|
| Sequence | MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471709 | SPARC | secreted protein acidic and cysteine rich | 9598 | VGNC:7154 | OMA, EggNOG |
| Macaque | 712388 | SPARC | secreted protein acidic and cysteine rich | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20692 | Sparc | secreted acidic cysteine rich glycoprotein | 10090 | MGI:98373 | Inparanoid, OMA, EggNOG |
| Rat | 24791 | Sparc | secreted protein acidic and cysteine rich | 10116 | RGD:3742 | Inparanoid, OMA, EggNOG |
| Dog | 100855736 | SPARC | secreted protein acidic and cysteine rich | 9615 | VGNC:46701 | Inparanoid, OMA, EggNOG |
| Horse | 100060119 | SPARC | secreted protein acidic and cysteine rich | 9796 | VGNC:23478 | Inparanoid, OMA, EggNOG |
| Cow | 282077 | SPARC | secreted protein acidic and cysteine rich | 9913 | VGNC:35171 | Inparanoid, OMA, EggNOG |
| Opossum | 100024756 | SPARC | secreted protein acidic and cysteine rich | 13616 | | Inparanoid, EggNOG |
| Platypus | 100075328 | SPARC | secreted protein acidic and cysteine rich | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 386571 | SPARC | secreted protein acidic and cysteine rich | 9031 | CGNC:3072 | Inparanoid, OMA |
| Anole lizard | 100554604 | sparc | secreted protein acidic and cysteine rich | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 394973 | sparc | secreted protein, acidic, cysteine-rich (osteonectin) | 8364 | XB-GENE-1009630 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321357 | sparc | secreted protein, acidic, cysteine-rich (osteonectin) | 7955 | ZDB-GENE-030131-9 | Inparanoid, OMA |
| C. elegans | 176931 | ost-1 | OSTeonectin (SPARC) related | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
